BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D18 (949 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_27141| Best HMM Match : zf-CW (HMM E-Value=3.1) 28 9.6 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/62 (22%), Positives = 31/62 (50%) Frame = +2 Query: 287 SSRNVVNNLIIDKXRNTMEYCYKLWVGNGQEIVRKYFPLNFRTHHGRKLCQDHLQKLQPR 466 +SRN V + ++ + C+K + ++ + +Y ++ R HH R L++L+ + Sbjct: 660 TSRNKVETKLAEQEKTIA--CHKDEIKTARDTINEYKEISARNHHERDKMMTRLKELETQ 717 Query: 467 SE 472 E Sbjct: 718 ME 719 >SB_27141| Best HMM Match : zf-CW (HMM E-Value=3.1) Length = 397 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 270 AXRFQALTDSTGGGAGEDAVVQLXLEGLVRSVRGECNDAR--AGGEPCT 130 A +F+ S GGG + Q LEG +++ N AR GG+PC+ Sbjct: 334 AQQFKQAILSNGGGVISLVMTQKELEGNFKAILTIVNHARRGQGGKPCS 382 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,930,476 Number of Sequences: 59808 Number of extensions: 443527 Number of successful extensions: 988 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -