BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D17 (905 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45610.1 68416.m04926 Dof-type zinc finger domain-containing ... 32 0.45 At3g26240.1 68416.m03274 DC1 domain-containing protein contains ... 30 1.8 At1g47655.1 68414.m05294 Dof-type zinc finger domain-containing ... 30 1.8 At5g17500.1 68418.m02053 glycosyl hydrolase family 5 protein / c... 29 3.2 At2g02630.1 68415.m00202 DC1 domain-containing protein contains ... 29 3.2 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 3.2 At1g21326.1 68414.m02666 VQ motif-containing protein contains PF... 29 3.2 At5g05680.1 68418.m00625 nuclear pore complex protein-related co... 29 5.6 At5g37620.1 68418.m04531 DC1 domain-containing protein contains ... 28 7.4 At2g27200.1 68415.m03269 GTP-binding family protein contains Pfa... 28 7.4 At5g60200.1 68418.m07546 Dof-type zinc finger domain-containing ... 28 9.8 At5g37850.1 68418.m04557 pfkB-type carbohydrate kinase family pr... 28 9.8 At4g01760.1 68417.m00229 DC1 domain-containing protein similar t... 28 9.8 >At3g45610.1 68416.m04926 Dof-type zinc finger domain-containing protein identical to dof6 zinc finger protein GI:5689615 from [Arabidopsis thaliana] Length = 245 Score = 32.3 bits (70), Expect = 0.45 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 421 DVQPSRSPRTPCRYLPPGTRVRCP---SIARPPCGWSGYSAPAPRSQRPSCRR 272 D Q + P + R PP +RCP S C ++ YS PR SCRR Sbjct: 20 DYQNQKKPLSATRPAPPEQSLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRR 72 >At3g26240.1 68416.m03274 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 922 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -3 Query: 276 EGCDCVLDDDEAHGPRQVRHVHRDQTVPLLF---TDDVAIGCYFCEKRAESERE-YNC 115 E CD L A P+QVR+ H +PL + T D+ C CE + E Y C Sbjct: 764 EECDYALCFKCATLPQQVRYKHDKHILPLSYGKKTSDMTYWCEACEGKINPEEGFYRC 821 >At1g47655.1 68414.m05294 Dof-type zinc finger domain-containing protein Length = 209 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -2 Query: 418 VQPSRSPRTPCRYLPPGTRVRCPSIARPPCGWSGYSAPAPRSQRPSCRR 272 VQPS + P P RC S C ++ Y+ PR SCRR Sbjct: 13 VQPSTAAYPPPNLAEPLPCPRCNSTTTKFCYYNNYNLAQPRYYCKSCRR 61 >At5g17500.1 68418.m02053 glycosyl hydrolase family 5 protein / cellulase family protein predicted protein F3F19.15 - Arabidopsis thaliana, EMBL:AC007357 Length = 526 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = -1 Query: 209 GIKPSHCFLLTTSQSAAISVRSELRASASTTAEWRRAMSRSGACQHVSTRAXC*IL*GI 33 G+K + +S+R+ELR T+ +W + M + H S IL G+ Sbjct: 183 GLKKMATIFMNVKNVVGMSLRNELRGYNHTSKDWYKYMQKGAEAVHTSNPNVLVILSGL 241 >At2g02630.1 68415.m00202 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 440 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = -3 Query: 273 GCDCVLDDDEAHGPRQVRHVHRDQTVPLLFTDDVAIGCYFCEKRAESEREYNC 115 GCD +L + A PR+ H + L+F +D C C R + Y C Sbjct: 193 GCDFILHETCADAPRRKVHPLHPHPLKLIFYEDNCFHCKAC-WRTSTAFGYRC 244 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 412 PSRSPRTPCRYLPPGTRVRCPSIARPPCGWSGYSAPAPRSQRPS 281 PS SP P Y P V CP + P P+PR PS Sbjct: 552 PSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPS 595 >At1g21326.1 68414.m02666 VQ motif-containing protein contains PF05678: VQ motif Length = 239 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -2 Query: 454 GPRVVPVGVRADV-----QPSRSPRTPCRYLPPGTRVRCPSIARPPCG 326 GPR +P+ VR D +P +P P + PP T + PS +RPP G Sbjct: 13 GPRPIPLKVRGDSHKIIKKPPLAPPHP-QPQPPQTHQQEPSQSRPPPG 59 >At5g05680.1 68418.m00625 nuclear pore complex protein-related contains weak similarity to Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88 kDa nuclear pore complex protein) (Swiss-Prot:Q99567) [Homo sapiens] Length = 810 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 160 AADCDVVSKKQWDGLIPVHVS 222 + +C V K WD L+P+HVS Sbjct: 545 SGECIVAEMKTWDLLLPIHVS 565 >At5g37620.1 68418.m04531 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -3 Query: 306 QLLAASVRPAEGCDCVLDDDEAHGPRQVRHVHRDQTVPLLFTDDVAIGCYFC 151 Q+L+ + C+ L A+ PR+ HV+R+ LL + + C+ C Sbjct: 409 QILSEPFYSCKQCNFKLHQKCANHPRKKHHVYRNLPFTLLTSGNEIFQCWLC 460 >At2g27200.1 68415.m03269 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 537 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/82 (24%), Positives = 33/82 (40%) Frame = -3 Query: 309 HQLLAASVRPAEGCDCVLDDDEAHGPRQVRHVHRDQTVPLLFTDDVAIGCYFCEKRAESE 130 H+ + SV D +++ +A ++ +H D P+ D G A+ Sbjct: 35 HKKVLESVTEVSDIDAIIE--QAEEAERLFAIHHDSATPVPINMDT--GSSSSGITAKEW 90 Query: 129 REYNCRVEAGHVEERRVPARQH 64 +E R EA H +VP R H Sbjct: 91 KEQRMREEALHASSLQVPRRPH 112 >At5g60200.1 68418.m07546 Dof-type zinc finger domain-containing protein similar to dof6 zinc finger protein GI:5689615 from [Arabidopsis thaliana] Length = 257 Score = 27.9 bits (59), Expect = 9.8 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = -2 Query: 415 QPSRSPRTPC-RYLPPGTRVRCP---SIARPPCGWSGYSAPAPRSQRPSCRR 272 Q SP T R PP +RCP S C ++ YS PR SCRR Sbjct: 36 QKKPSPATAVTRPQPPELALRCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRR 87 >At5g37850.1 68418.m04557 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 309 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 321 LDIPHQLLAASVRPAEGCDCVLDDD-EAHGPRQVRHVHRDQTVPL 190 L++ ++L + + CD V+ D+ + + P ++ HV+R++ VPL Sbjct: 106 LEVINKLRSVNPNLTYVCDPVMGDEGKLYVPEELVHVYREKVVPL 150 >At4g01760.1 68417.m00229 DC1 domain-containing protein similar to T15B16.10 similar to A. thaliana CHP-rich proteins encoded by T10M13, GenBank accession number AF001308 Length = 667 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = -3 Query: 309 HQLLAASVRPAEGCDCVLDDDEAHGPRQVRHVHRDQTVPLLFTDDVAIGCYFCEK 145 H + S CD +L + A PR+ HV ++ + L+ ++ GC C K Sbjct: 411 HPISPQSFYGCMDCDFILHQNCAGFPRRKWHVLHNERLALVTSEVNIFGCSACHK 465 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,907,502 Number of Sequences: 28952 Number of extensions: 285204 Number of successful extensions: 1065 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -