BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D11 (895 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13320.1 68418.m01531 auxin-responsive GH3 family protein sim... 29 5.5 At5g57080.1 68418.m07126 hypothetical protein 28 9.6 >At5g13320.1 68418.m01531 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +2 Query: 431 KPLQDLNEYINRELKNLPDNIQVQIKDDLSKD 526 KP+ D+NE ++LK+L N++ I+D+L ++ Sbjct: 2 KPIFDINETFEKQLKDLTSNVK-SIQDNLLEE 32 >At5g57080.1 68418.m07126 hypothetical protein Length = 62 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 332 KMPAGVTWGQYISFSIAAMLSMLAGSQVVHLYYKPLQDLNEYINRELKNLPDNI 493 K+P G ++ + S+LAG+ VVH YKP L + E+ D++ Sbjct: 8 KLPTGTP--SLAMSTLVVVASLLAGASVVHNIYKPDLSLPPLESSEVAKKDDSV 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,828,795 Number of Sequences: 28952 Number of extensions: 228648 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -