BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D08 (867 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 29 3.0 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 29 3.0 At5g07390.1 68418.m00846 respiratory burst oxidase protein A (Rb... 29 4.0 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.3 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.3 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 7.0 At1g59750.2 68414.m06728 auxin-responsive factor (ARF1) identica... 28 7.0 At1g59750.1 68414.m06727 auxin-responsive factor (ARF1) identica... 28 7.0 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 28 7.0 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 709 FPKGRKAXQVSGKRQGRNRR 650 +P G+KA Q+ GK GRNRR Sbjct: 750 YPWGKKALQILGKLGGRNRR 769 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/65 (27%), Positives = 26/65 (40%) Frame = -2 Query: 593 FATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS 414 F S S+D+ YG A P YGS P G+ + YP + + P++ Sbjct: 138 FGFSSYSMDYNYPTSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYPYLQFAEGNGPVT 197 Query: 413 ELIPL 399 PL Sbjct: 198 GYAPL 202 >At5g07390.1 68418.m00846 respiratory burst oxidase protein A (RbohA) / NADPH oxidase identical to respiratory burst oxidase protein A from Arabidopsis thaliana [gi:3242781] Length = 902 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 542 RPPDEHHKNRRSSQRW 589 RPPDEH NR S+ W Sbjct: 667 RPPDEHRLNRADSKHW 682 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 351 PLPRSLTRCARSFGCGERYQLTQRR 425 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 351 PLPRSLTRCARSFGCGERYQLTQRR 425 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 342 PIRKPPLPARWPIH*CRKNLPHL 274 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 >At1g59750.2 68414.m06728 auxin-responsive factor (ARF1) identical to auxin response factor 1 GI:2245378 from [Arabidopsis thaliana] Length = 662 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +1 Query: 511 GRVAGVFXXXXXXXRASQKSTLKSEVAKPDRTIKIPGVSPWKLPRALSCSDPAAYRIPXP 690 G + GV S+ +LK + +P + VSPW+L ++ S P++ P P Sbjct: 310 GTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQ--PQP 367 Query: 691 P 693 P Sbjct: 368 P 368 >At1g59750.1 68414.m06727 auxin-responsive factor (ARF1) identical to auxin response factor 1 GI:2245378 from [Arabidopsis thaliana] Length = 665 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +1 Query: 511 GRVAGVFXXXXXXXRASQKSTLKSEVAKPDRTIKIPGVSPWKLPRALSCSDPAAYRIPXP 690 G + GV S+ +LK + +P + VSPW+L ++ S P++ P P Sbjct: 310 GTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQ--PQP 367 Query: 691 P 693 P Sbjct: 368 P 368 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = -2 Query: 593 FATSDLSVDFCDARQGG-GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPL 417 F S S+D+ Q YG A P YGS P G+ + YP + + P+ Sbjct: 138 FGFSSYSMDYNYPTQSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYPYLQFAEGNGPV 197 Query: 416 SELIPL 399 + PL Sbjct: 198 TGYAPL 203 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,234,637 Number of Sequences: 28952 Number of extensions: 352349 Number of successful extensions: 880 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2028915200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -