BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D02 (878 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 69 4e-12 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 60 2e-09 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 60 2e-09 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 53 4e-07 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 8e-07 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 45 9e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 44 1e-04 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 43 3e-04 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 43 3e-04 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 43 3e-04 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 43 3e-04 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 41 0.002 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 41 0.002 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 37 0.019 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 37 0.019 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 37 0.019 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 37 0.019 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 37 0.019 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 37 0.019 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 37 0.019 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 37 0.019 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 37 0.019 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.019 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 37 0.019 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 37 0.019 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 37 0.019 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 37 0.019 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 37 0.019 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 37 0.019 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 37 0.019 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 37 0.019 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 37 0.019 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 37 0.019 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 37 0.019 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 37 0.019 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 37 0.019 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 37 0.019 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 37 0.019 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 37 0.019 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 37 0.019 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 37 0.019 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 37 0.019 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 37 0.019 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 37 0.019 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 37 0.019 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 37 0.019 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 37 0.019 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 37 0.019 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 37 0.019 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 37 0.019 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 37 0.019 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 37 0.019 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 37 0.019 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 37 0.019 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 37 0.019 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 37 0.019 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 37 0.019 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 37 0.019 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 37 0.019 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 37 0.019 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 37 0.019 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 37 0.019 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 37 0.019 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 37 0.019 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 37 0.019 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 37 0.019 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 37 0.019 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.019 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 37 0.019 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 37 0.019 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 37 0.019 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 37 0.019 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 37 0.019 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 37 0.019 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 37 0.019 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 37 0.019 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 37 0.019 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 37 0.019 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 37 0.019 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 37 0.019 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 37 0.019 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 37 0.019 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 37 0.019 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 37 0.019 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 37 0.019 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 37 0.019 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 37 0.019 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 37 0.019 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 37 0.019 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 37 0.019 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 37 0.019 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 37 0.019 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 37 0.019 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 37 0.019 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 37 0.019 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 37 0.019 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 37 0.019 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 37 0.019 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 37 0.019 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 37 0.019 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 37 0.019 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 37 0.019 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 37 0.019 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 37 0.019 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 37 0.019 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 37 0.019 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 37 0.019 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 37 0.019 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 37 0.019 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 37 0.019 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 37 0.019 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 37 0.019 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 37 0.019 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 37 0.019 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 37 0.019 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 37 0.019 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 37 0.019 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 37 0.019 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 376 CXNESANXRGKAVCXLGXLPIPRSXIXCPRSFGCGXRYXLPQR 504 C NESAN RG+AVC LG LP+PRS C RSFGCG RY L QR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQR 142 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 69.3 bits (162), Expect = 4e-12 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = +1 Query: 376 CXNESANXRGKAVCXLGXLPIPRSXIXCPRSFGCGXRYXLPQR 504 C NESAN RG+AVC LG LP+PRS C RSFGCG RY L QR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQR 506 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 60.9 bits (141), Expect = 1e-09 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -2 Query: 631 RGAGPMXNASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 RGA PM NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 17 RGAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 60.1 bits (139), Expect = 2e-09 Identities = 35/84 (41%), Positives = 37/84 (44%) Frame = +1 Query: 526 NQGIXQEXPCXXKAXKRPXPVKRXRCWRXP*APPPXTSIQKSPPPQRWXNPTGLXRXXAX 705 NQGI QE C KA KRP VKR RCWR P TSI K R + Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 706 PPGXSLVXLSCPDPARLPXTCPPF 777 P + P RLP TCPPF Sbjct: 146 FPLEAPSCALLFRPCRLPDTCPPF 169 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 60.1 bits (139), Expect = 2e-09 Identities = 35/84 (41%), Positives = 37/84 (44%) Frame = +1 Query: 526 NQGIXQEXPCXXKAXKRPXPVKRXRCWRXP*APPPXTSIQKSPPPQRWXNPTGLXRXXAX 705 NQGI QE C KA KRP VKR RCWR P TSI K R + Sbjct: 115 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 174 Query: 706 PPGXSLVXLSCPDPARLPXTCPPF 777 P + P RLP TCPPF Sbjct: 175 FPLEAPSCALLFRPCRLPDTCPPF 198 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/60 (50%), Positives = 31/60 (51%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFEGXDTAXRSRTTXGXEXXSEESE 431 NASN FLR AF P HM P SPD D IT FE D A SR E SEE+E Sbjct: 8 NASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRESVSEEAE 67 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFEGXD 488 NASN FLR AF P HM FP SPD DNRIT FE D Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 766 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 816 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 8 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 58 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 31 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 81 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 413 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 463 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 562 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 612 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 30 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 80 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -3 Query: 609 TPATXPFYGXXPFGGLXXTWXFLXYXXXXXXXXXXXLREXIPLSAAERPXA 457 TPAT PFYG PF GL T FL Y L E IPL+AAERP A Sbjct: 8 TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 58 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 100 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 66 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM +P SPD DNRIT FE Sbjct: 8 NASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM FP SPD DNRIT F+ Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -2 Query: 610 NASNXXFLRVXAFWXPXXHMVFPXXSPDXXDNRITXFE 497 NASN FLR AF P HM F SPD DNRIT FE Sbjct: 24 NASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.0 bits (104), Expect = 4e-05 Identities = 31/53 (58%), Positives = 32/53 (60%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM*XKGXQKAXTRK 590 S SSL SL VVRLR AVS SK VIRLS +SGD G M G KA RK Sbjct: 15 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMRLYG--KAIIRK 65 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM 554 S SSL SL VVRLR AVS SK VIRLS +SGD G M Sbjct: 61 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM 554 S SSL SL VVRLR AVS SK VIRLS +SGD G M Sbjct: 583 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM 554 S SSL SL VVRLR AVS SK VIRLS +SGD G M Sbjct: 10 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 9e-05 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM 554 S SSL SL VVRLR AVS SK VIRLS +SGD G M Sbjct: 148 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/69 (43%), Positives = 37/69 (53%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXGXTM*XKGXQKAXTRKKXXLLAX 611 S SSL SL VVRLR AVS SK VIRLS +SGD G + +A KK L Sbjct: 44 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI--LFCCRASEHKKVPLYTI 101 Query: 612 XIGPAPLXQ 638 + P+ + + Sbjct: 102 YVNPSNINE 110 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 456 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 493 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 69 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 106 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 317 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 354 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 217 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 254 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 262 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 299 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 7 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 44 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 10 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 47 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 271 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 308 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR AVS SK VIRLS +SGD G Sbjct: 77 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAG 114 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 432 SDSSLXXSLPXVVRLRXAVSXPSKXVIRLSXQSGDXXG 545 S SSL SL VVRLR A S SK VIRLS +SGD G Sbjct: 10 SASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAG 47 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPTPGERRFAYWA Sbjct: 46 ALMNRPTPGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/36 (58%), Positives = 21/36 (58%) Frame = +2 Query: 320 NNXXHXMFQVQGEVWEVFXAXMNRPTPGERRFAYWA 427 N FQV V V A MNRPT GERRFAYWA Sbjct: 106 NKLRQKHFQVGKPV--VPAALMNRPTRGERRFAYWA 139 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWL 201 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 365 EVFXAXMNRPTPGERRFAYWA 427 +V A MNRPT GERRFAYWA Sbjct: 5 DVPAALMNRPTRGERRFAYWA 25 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF C R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCRERKWL 87 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 117 ALMNRPTRGERRFAYWA 133 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 74 ALMNRPTRGERRFAYWA 90 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 122 ALMNRPTRGERRFAYWA 138 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 83 ALMNRPTRGERRFAYWA 99 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 121 ALMNRPTRGERRFAYWA 137 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWL 199 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 143 ALMNRPTRGERRFAYWA 159 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 245 ALMNRPTRGERRFAYWA 261 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWL 323 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 65 ALMNRPTRGERRFAYWA 81 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 83 ALMNRPTRGERRFAYWA 99 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 70 ALMNRPTRGERRFAYWA 86 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWL 148 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 141 ALMNRPTRGERRFAYWA 157 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 95 ALMNRPTRGERRFAYWA 111 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWL 173 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 59 ALMNRPTRGERRFAYWA 75 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 155 ALMNRPTRGERRFAYWA 171 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 52 ALMNRPTRGERRFAYWA 68 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWL 130 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 53 ALMNRPTRGERRFAYWA 69 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 82 ALMNRPTRGERRFAYWA 98 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 200 ALMNRPTRGERRFAYWA 216 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWL 278 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 42 ALMNRPTRGERRFAYWA 58 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 41 ALMNRPTRGERRFAYWA 57 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 342 ALMNRPTRGERRFAYWA 358 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWL 420 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 197 ALMNRPTRGERRFAYWA 213 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWL 275 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 97 ALMNRPTRGERRFAYWA 113 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWL 175 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 83 ALMNRPTRGERRFAYWA 99 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWL 161 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 560 ALMNRPTRGERRFAYWA 576 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWL 638 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 272 ALMNRPTRGERRFAYWA 288 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 316 ALMNRPTRGERRFAYWA 332 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWL 394 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 159 ALMNRPTRGERRFAYWA 175 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWL 237 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 117 ALMNRPTRGERRFAYWA 133 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWL 195 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 81 ALMNRPTRGERRFAYWA 97 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 43 ALMNRPTRGERRFAYWA 59 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWL 121 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 53 ALMNRPTRGERRFAYWA 69 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 82 ALMNRPTRGERRFAYWA 98 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWL 160 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 477 ALMNRPTRGERRFAYWA 493 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 74 ALMNRPTRGERRFAYWA 90 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 37 ALMNRPTRGERRFAYWA 53 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 128 ALMNRPTRGERRFAYWA 144 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWL 206 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 51 ALMNRPTRGERRFAYWA 67 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 65 ALMNRPTRGERRFAYWA 81 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 86 ALMNRPTRGERRFAYWA 102 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWL 164 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 5506 ALMNRPTRGERRFAYWA 5522 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 102 ALMNRPTRGERRFAYWA 118 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 189 ALMNRPTRGERRFAYWA 205 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 12 ALMNRPTRGERRFAYWA 28 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWL 90 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 62 ALMNRPTRGERRFAYWA 78 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 549 ALMNRPTRGERRFAYWA 565 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWL 627 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 48 ALMNRPTRGERRFAYWA 64 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 163 ALMNRPTRGERRFAYWA 179 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 62 ALMNRPTRGERRFAYWA 78 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 649 ALMNRPTRGERRFAYWA 665 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 120 ALMNRPTRGERRFAYWA 136 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 170 ALMNRPTRGERRFAYWA 186 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 45 ALMNRPTRGERRFAYWA 61 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWL 123 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 66 ALMNRPTRGERRFAYWA 82 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWL 144 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 88 ALMNRPTRGERRFAYWA 104 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWL 166 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 65 ALMNRPTRGERRFAYWA 81 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWL 143 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 95 ALMNRPTRGERRFAYWA 111 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 54 ALMNRPTRGERRFAYWA 70 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 55 ALMNRPTRGERRFAYWA 71 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 65 ALMNRPTRGERRFAYWA 81 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 81 ALMNRPTRGERRFAYWA 97 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 358 ALMNRPTRGERRFAYWA 374 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 79 ALMNRPTRGERRFAYWA 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 48 ALMNRPTRGERRFAYWA 64 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWL 126 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 186 ALMNRPTRGERRFAYWA 202 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWL 264 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 577 ALMNRPTRGERRFAYWA 593 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWL 655 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 299 ALMNRPTRGERRFAYWA 315 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWL 377 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWL 124 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 72 ALMNRPTRGERRFAYWA 88 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 803 ALMNRPTRGERRFAYWA 819 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWL 881 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 582 ALMNRPTRGERRFAYWA 598 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 138 ALMNRPTRGERRFAYWA 154 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 188 ALMNRPTRGERRFAYWA 204 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWL 266 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 87 ALMNRPTRGERRFAYWA 103 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWL 165 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 217 ALMNRPTRGERRFAYWA 233 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 488 ALMNRPTRGERRFAYWA 504 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWL 566 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 33 ALMNRPTRGERRFAYWA 49 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWL 111 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 146 ALMNRPTRGERRFAYWA 162 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 143 ALMNRPTRGERRFAYWA 159 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 933 ALMNRPTRGERRFAYWA 949 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWL 1011 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 59 ALMNRPTRGERRFAYWA 75 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWL 137 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 101 ALMNRPTRGERRFAYWA 117 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 438 ALMNRPTRGERRFAYWA 454 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWL 516 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 42 ALMNRPTRGERRFAYWA 58 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWL 120 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 45 ALMNRPTRGERRFAYWA 61 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 71 ALMNRPTRGERRFAYWA 87 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 425 ALMNRPTRGERRFAYWA 441 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 234 ALMNRPTRGERRFAYWA 250 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWL 312 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 241 ALMNRPTRGERRFAYWA 257 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 201 ALMNRPTRGERRFAYWA 217 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 144 ALMNRPTRGERRFAYWA 160 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 37 ALMNRPTRGERRFAYWA 53 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 41 ALMNRPTRGERRFAYWA 57 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 753 ALMNRPTRGERRFAYWA 769 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 46 ALMNRPTRGERRFAYWA 62 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 53 ALMNRPTRGERRFAYWA 69 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWL 131 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 64 ALMNRPTRGERRFAYWA 80 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 23 ALMNRPTRGERRFAYWA 39 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWL 101 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 118 ALMNRPTRGERRFAYWA 134 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 143 ALMNRPTRGERRFAYWA 159 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWL 221 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 104 ALMNRPTRGERRFAYWA 120 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 228 ALMNRPTRGERRFAYWA 244 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWL 306 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 54 ALMNRPTRGERRFAYWA 70 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWL 132 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 102 ALMNRPTRGERRFAYWA 118 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWL 180 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 137 ALMNRPTRGERRFAYWA 153 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 62 ALMNRPTRGERRFAYWA 78 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWL 140 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 179 ALMNRPTRGERRFAYWA 195 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 1682 ALMNRPTRGERRFAYWA 1698 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 104 ALMNRPTRGERRFAYWA 120 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWL 182 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWL 87 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 72 ALMNRPTRGERRFAYWA 88 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWL 150 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 116 ALMNRPTRGERRFAYWA 132 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 74 ALMNRPTRGERRFAYWA 90 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 102 ALMNRPTRGERRFAYWA 118 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWL 104 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 41 ALMNRPTRGERRFAYWA 57 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWL 119 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 81 ALMNRPTRGERRFAYWA 97 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWL 159 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 50 ALMNRPTRGERRFAYWA 66 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 944 ALMNRPTRGERRFAYWA 960 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWL 1022 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 91 ALMNRPTRGERRFAYWA 107 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWL 169 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 88 ALMNRPTRGERRFAYWA 104 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 424 ALMNRPTRGERRFAYWA 440 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWL 502 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 54 ALMNRPTRGERRFAYWA 70 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS R+F CG R L Sbjct: 105 ICDTGYIPLPRSLTRYARTFDCGERKWL 132 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 106 ALMNRPTRGERRFAYWA 122 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWL 184 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 184 ALMNRPTRGERRFAYWA 200 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 472 ALMNRPTRGERRFAYWA 488 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWL 550 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 79 ALMNRPTRGERRFAYWA 95 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWL 157 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 470 ALMNRPTRGERRFAYWA 486 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWL 548 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 92 ALMNRPTRGERRFAYWA 108 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWL 170 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 50 ALMNRPTRGERRFAYWA 66 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 50 ALMNRPTRGERRFAYWA 66 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWL 128 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 48 ALMNRPTRGERRFAYWA 64 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 94 ALMNRPTRGERRFAYWA 110 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWL 172 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 101 ALMNRPTRGERRFAYWA 117 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWL 179 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 240 ALMNRPTRGERRFAYWA 256 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWL 318 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 151 ALMNRPTRGERRFAYWA 167 >SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 78 ALMNRPTRGERRFAYWA 94 >SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 26 ALMNRPTRGERRFAYWA 42 >SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 9 ALMNRPTRGERRFAYWA 25 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 120 ALMNRPTRGERRFAYWA 136 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWL 198 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 1155 ALMNRPTRGERRFAYWA 1171 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWL 1233 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 51 ALMNRPTRGERRFAYWA 67 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWL 129 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 377 AXMNRPTPGERRFAYWA 427 A MNRPT GERRFAYWA Sbjct: 71 ALMNRPTRGERRFAYWA 87 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 412 VCXLGXLPIPRSXIXCPRSFGCGXRYXL 495 +C G +P+PRS RSF CG R L Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWL 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,364,597 Number of Sequences: 59808 Number of extensions: 190742 Number of successful extensions: 1722 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1647 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -