Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP05_F_C21
         (1012 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g20980.1 68414.m02626 SPL1-Related2 protein (SPL1R2) strong s...    29   4.9  

>At1g20980.1 68414.m02626 SPL1-Related2 protein (SPL1R2) strong
           similarity to SPL1-Related2 protein [Arabidopsis
           thaliana] GI:6006427; contains Pfam profile PF03110: SBP
           domain
          Length = 1035

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = +3

Query: 321 MENLILPFSPVEAERNRFVVRSPQQDSVCRGRSFQSSL 434
           +E     FS V  ER+    +SP QDS  RG+  +SSL
Sbjct: 351 LEKRTFGFSSVGGERSSSSNQSPSQDSDSRGQDTRSSL 388


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,095,572
Number of Sequences: 28952
Number of extensions: 255404
Number of successful extensions: 489
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 479
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 489
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2479989240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)