BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C21 (1012 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20980.1 68414.m02626 SPL1-Related2 protein (SPL1R2) strong s... 29 4.9 >At1g20980.1 68414.m02626 SPL1-Related2 protein (SPL1R2) strong similarity to SPL1-Related2 protein [Arabidopsis thaliana] GI:6006427; contains Pfam profile PF03110: SBP domain Length = 1035 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 321 MENLILPFSPVEAERNRFVVRSPQQDSVCRGRSFQSSL 434 +E FS V ER+ +SP QDS RG+ +SSL Sbjct: 351 LEKRTFGFSSVGGERSSSSNQSPSQDSDSRGQDTRSSL 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,095,572 Number of Sequences: 28952 Number of extensions: 255404 Number of successful extensions: 489 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2479989240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -