BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C18 (904 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33985.1 68417.m04822 expressed protein 30 1.8 At4g21850.2 68417.m03160 methionine sulfoxide reductase domain-c... 30 1.8 At4g21850.1 68417.m03159 methionine sulfoxide reductase domain-c... 30 1.8 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 153 HEMRSRA*AEEAWLRRKSHEELGMSGRAR 239 H A EEAWLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At4g21850.2 68417.m03160 methionine sulfoxide reductase domain-containing protein / SeIR domain-containing protein low similarity to pilin-like transcription factor [Homo sapiens] GI:5059062, SP|P14930 Peptide methionine sulfoxide reductase msrA/msrB (EC 1.8.4.6) {Neisseria gonorrhoeae}; contains Pfam profile PF01641: SelR domain Length = 121 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 376 LLTDDITKAAKCAKKIYKRH-RFDAWYGWKNHCQXLPGLI 492 L D I A CA +YK +FD+ GW + +PG I Sbjct: 50 LFDDGIYSCAGCATPLYKSTTKFDSGCGWPSFFDAIPGAI 89 >At4g21850.1 68417.m03159 methionine sulfoxide reductase domain-containing protein / SeIR domain-containing protein low similarity to pilin-like transcription factor [Homo sapiens] GI:5059062, SP|P14930 Peptide methionine sulfoxide reductase msrA/msrB (EC 1.8.4.6) {Neisseria gonorrhoeae}; contains Pfam profile PF01641: SelR domain Length = 143 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 376 LLTDDITKAAKCAKKIYKRH-RFDAWYGWKNHCQXLPGLI 492 L D I A CA +YK +FD+ GW + +PG I Sbjct: 50 LFDDGIYSCAGCATPLYKSTTKFDSGCGWPSFFDAIPGAI 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,331,223 Number of Sequences: 28952 Number of extensions: 212265 Number of successful extensions: 584 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -