BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C09 (921 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 1.1 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 24 1.9 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.6 bits (51), Expect = 1.1 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = +1 Query: 196 NGRAGL*ESRSHDFVDHVGPCDVPQCFCDRPNVRNTKTGKCVRESEC**NC 348 NG+A SR H F+ G C CD + K + E +C NC Sbjct: 752 NGQAYFPGSRFHPFLIPTGFDSCTVCTCDAKYL-EIKCKRIYNEKQCCKNC 801 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 206 PDCENPEVTISLTTWAHATYHSASATGLMS 295 P+CENPE + ++T A G S Sbjct: 14 PECENPETELLVSTKRSTISQGCKACGYHS 43 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,564 Number of Sequences: 336 Number of extensions: 2677 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25754817 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -