Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP05_F_C09
         (921 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g58160.1 68418.m07280 formin homology 2 domain-containing pro...    31   1.4  

>At5g58160.1 68418.m07280 formin homology 2 domain-containing
           protein / FH2 domain-containing protein low similarity
           to SP|Q05858 Formin (Limb deformity protein) {Gallus
           gallus}; contains Pfam profile PF02181: Formin Homology
           2(FH2) Domain
          Length = 1307

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 20/64 (31%), Positives = 30/64 (46%)
 Frame = +2

Query: 71  ENVSNEKFIVLLFVVAAVGYVTGHISNEKMPKGEHSVLYCPQMAEPDCENPEVTISLTTW 250
           + V NEK ++ L     +   T H S E   K  +S+L  PQ +     NP  T+S+  +
Sbjct: 591 QTVPNEKNLITLPPTPPLAS-TSHASPEPSSKTTNSLLLSPQASPATPTNPSKTVSVDFF 649

Query: 251 AHAT 262
             AT
Sbjct: 650 GAAT 653


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,609,797
Number of Sequences: 28952
Number of extensions: 253454
Number of successful extensions: 718
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 561
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 679
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2188225800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)