BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B23 (887 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.60 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.60 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.60 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.60 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 0.60 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.60 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.60 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 4.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 4.2 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 22 5.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.6 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 98 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 135 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.4 bits (53), Expect = 0.60 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 842 GVXSPXAXSXLFPGXPLASTAFAXEVPSTSRSRNGASST 726 G+ SP + S PG P STA + + S + S + SST Sbjct: 142 GLTSPLSVSTSPPGKPATSTA-SQNLSSPASSTSSTSST 179 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 410 GWLKNGRLSS 439 GWLK G+LSS Sbjct: 124 GWLKKGKLSS 133 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 520 SRSPYW*NQCRRHVERIHRLSSHQC 446 + P+ ++CR R H L H+C Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 292 LVDQPG-KLRKLFPSILPKQFSXXWVRLTSVV 200 LV +P +LRK F +L K W+ L + V Sbjct: 136 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 167 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 292 LVDQPG-KLRKLFPSILPKQFSXXWVRLTSVV 200 LV +P +LRK F +L K W+ L + V Sbjct: 369 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 400 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 292 LVDQPG-KLRKLFPSILPKQFSXXWVRLTSVV 200 LV +P +LRK F +L K W+ L + V Sbjct: 369 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 400 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,702 Number of Sequences: 336 Number of extensions: 3966 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -