BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N22 (876 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01490.1 68415.m00072 phytanoyl-CoA dioxygenase (PhyH) family... 35 0.062 At2g38280.2 68415.m04702 AMP deaminase, putative / myoadenylate ... 31 1.3 At2g38280.1 68415.m04701 AMP deaminase, putative / myoadenylate ... 31 1.3 At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel... 29 3.1 At2g41020.2 68415.m05066 WW domain-containing protein contains P... 29 5.4 At2g41020.1 68415.m05067 WW domain-containing protein contains P... 29 5.4 At2g26710.1 68415.m03204 cytochrome P450, putative 28 7.1 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 28 9.4 At3g30848.1 68416.m03974 hypothetical protein contains similarit... 28 9.4 At1g79570.1 68414.m09276 protein kinase family protein low simil... 28 9.4 >At2g01490.1 68415.m00072 phytanoyl-CoA dioxygenase (PhyH) family protein contains Pfam profile PF05721: Phytanoyl-CoA dioxygenase (PhyH); weak similarity to Phytanoyl-CoA dioxygenase, peroxisomal precursor (EC 1.14.11.18) (Phytanoyl-CoA alpha-hydroxylase) (PhyH) (Phytanic acid oxidase) (Swiss-Prot:O14832) [Homo sapiens] Length = 283 Score = 35.1 bits (77), Expect = 0.062 Identities = 36/188 (19%), Positives = 72/188 (38%), Gaps = 27/188 (14%) Frame = +2 Query: 104 LTEEQKKFYEENGYIVLKNVLSEEDLCSITIEYNNLFNR-----------KNQEKMESSW 250 LT +Q F+ GY+V+++ SE+++ + + L N+ KNQ+ ++ Sbjct: 7 LTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLNQFDCSVSSIFSTKNQKHTTDNY 66 Query: 251 ---------------VGSDHNDRKHDKNFTVKGI-HNLQFHHAVFSKFIFNDNLLDALED 382 D K K ++ + H L ++ F ++ +L Sbjct: 67 FFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGHALHELDPLYKDFTYSSKF-SSLAS 125 Query: 383 VMNTKNIIFHHTKAHYKPPEKGAAYPMHQDYHYFPYEKDSMVASFLHLDAADPKNGCLYV 562 + + + + +K P G HQD + + S ++ L+ + NGCL+ Sbjct: 126 SLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVYTDPQSCTGLWIALEDSTLVNGCLWA 185 Query: 563 YPGFTQTG 586 PG + G Sbjct: 186 IPGSHKNG 193 >At2g38280.2 68415.m04702 AMP deaminase, putative / myoadenylate deaminase, putative similar to SP|P15274 AMP deaminase (EC 3.5.4.6) (Myoadenylate deaminase) {Saccharomyces cerevisiae}; contains Pfam profile PF00962: Adenosine/AMP deaminase Length = 839 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +2 Query: 92 IMVHLTEEQKKFYEENGYIVLKNVLSEEDLCSITIEYNNLFNRKNQEKMESSWVGSDHND 271 + +HLT+E EE LS DLC I N+++ ++S W+G D+ Sbjct: 739 LQIHLTKEP--LVEEYSIAASVWKLSACDLCEIA--RNSVYQSGFSHALKSHWIGKDYYK 794 Query: 272 RKHDKN 289 R D N Sbjct: 795 RGPDGN 800 >At2g38280.1 68415.m04701 AMP deaminase, putative / myoadenylate deaminase, putative similar to SP|P15274 AMP deaminase (EC 3.5.4.6) (Myoadenylate deaminase) {Saccharomyces cerevisiae}; contains Pfam profile PF00962: Adenosine/AMP deaminase Length = 839 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +2 Query: 92 IMVHLTEEQKKFYEENGYIVLKNVLSEEDLCSITIEYNNLFNRKNQEKMESSWVGSDHND 271 + +HLT+E EE LS DLC I N+++ ++S W+G D+ Sbjct: 739 LQIHLTKEP--LVEEYSIAASVWKLSACDLCEIA--RNSVYQSGFSHALKSHWIGKDYYK 794 Query: 272 RKHDKN 289 R D N Sbjct: 795 RGPDGN 800 >At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 1280 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 110 EEQKKFYEENGYIVLKNVLSEEDLCSITIEYNNLFNRKNQEKMESSW 250 EEQ++ E +L++++ E S T NN+ NR ++ E SW Sbjct: 278 EEQQQNVTEKWIHMLRSLMDERGPWSATPFPNNILNRWKLDRTEDSW 324 >At2g41020.2 68415.m05066 WW domain-containing protein contains Pfam domain PF00397: WW domain Length = 382 Score = 28.7 bits (61), Expect = 5.4 Identities = 25/104 (24%), Positives = 45/104 (43%) Frame = +2 Query: 353 NDNLLDALEDVMNTKNIIFHHTKAHYKPPEKGAAYPMHQDYHYFPYEKDSMVASFLHLDA 532 ++NL + L+ + + I+ A PE +A ++ P++ ++ +DA Sbjct: 143 SNNLPEYLKQKLKARGILRDGAGAVTSNPEDTSAVSWNRQAT-LPFQANASTLPLGWVDA 201 Query: 533 ADPKNGCLYVYPGFTQTGTSGRRWC*RRKLSFC*SEKVPYIESE 664 DP +G Y Y TGT +W +LS+ S P + E Sbjct: 202 KDPASGATYYYN--QHTGTC--QWERPVELSYATSSAPPVLSKE 241 >At2g41020.1 68415.m05067 WW domain-containing protein contains Pfam domain PF00397: WW domain Length = 463 Score = 28.7 bits (61), Expect = 5.4 Identities = 25/104 (24%), Positives = 45/104 (43%) Frame = +2 Query: 353 NDNLLDALEDVMNTKNIIFHHTKAHYKPPEKGAAYPMHQDYHYFPYEKDSMVASFLHLDA 532 ++NL + L+ + + I+ A PE +A ++ P++ ++ +DA Sbjct: 143 SNNLPEYLKQKLKARGILRDGAGAVTSNPEDTSAVSWNRQAT-LPFQANASTLPLGWVDA 201 Query: 533 ADPKNGCLYVYPGFTQTGTSGRRWC*RRKLSFC*SEKVPYIESE 664 DP +G Y Y TGT +W +LS+ S P + E Sbjct: 202 KDPASGATYYYN--QHTGTC--QWERPVELSYATSSAPPVLSKE 241 >At2g26710.1 68415.m03204 cytochrome P450, putative Length = 520 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = -3 Query: 412 MENNVLSVHYILESVQKIVVE--DKLGEHGMVELKVVDAF 299 MEN L V +L+SV +V + DKL E+G VE+ V + F Sbjct: 165 MENLKLLVPVVLKSVTDMVDKWSDKLSENGEVEVDVYEWF 204 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 362 LLDALEDVMNTKNIIFHHTKAHYKPPEKGAA 454 L+ LE + K++IF T+ +PP+KGAA Sbjct: 80 LVRELEKKFSGKDVIFVTTRRIMRPPKKGAA 110 >At3g30848.1 68416.m03974 hypothetical protein contains similarity to hypothetical proteins Length = 156 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 802 RRWSSAGCCXHXAAYVADRCE 740 + WSS+GCC +YVA E Sbjct: 32 KMWSSSGCCKFVGSYVASTKE 52 >At1g79570.1 68414.m09276 protein kinase family protein low similarity to EDR1 [Arabidopsis thaliana] GI:11127925 Length = 1248 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 152 LKNVLSEEDLCSITIEYNNLFNRKNQEKM 238 L +V SEEDL ++ EYN + NR +K+ Sbjct: 243 LVSVSSEEDLQNMLEEYNEMENRGGSQKL 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,247,992 Number of Sequences: 28952 Number of extensions: 408882 Number of successful extensions: 1123 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -