BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N20 (829 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 29 4.6 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/65 (30%), Positives = 27/65 (41%) Frame = -2 Query: 342 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGSHIPSSDGQHCRSRR*GCCCTVSPRGL 163 C+ CS++ C SC GC L+ + + C+SR G CT S G Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCTGS--GC 281 Query: 162 G*KCP 148 KCP Sbjct: 282 DVKCP 286 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 29.1 bits (62), Expect = 4.6 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 5/98 (5%) Frame = +1 Query: 442 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKIHNTKYNQYLKMS---- 609 L+ GST S++ IA +T L S F R Y H T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 610 -TTTCNCNSRDRVCIRRQQR*QHQGAMVLPARQVRKRR 720 T C NSRDRV R + + + +++ + +++ RR Sbjct: 921 CTQACRLNSRDRVLQRTKHALRLRLRVLIQSCRLQLRR 958 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,995,464 Number of Sequences: 59808 Number of extensions: 427188 Number of successful extensions: 1080 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -