BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N17 (888 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 24 1.4 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 24 1.4 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 24 1.4 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 22 5.6 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 5.6 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 7.4 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 38 DLFFFSLSTFVSERFTKMAKRTKKV 112 D+F LST ++ RFT++ RT+ + Sbjct: 231 DVFVMLLSTALAYRFTQVTDRTQSM 255 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 38 DLFFFSLSTFVSERFTKMAKRTKKV 112 D+F LST ++ RFT++ RT+ + Sbjct: 231 DVFVMLLSTALAYRFTQVTDRTQSM 255 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 38 DLFFFSLSTFVSERFTKMAKRTKKV 112 D+F LST ++ RFT++ RT+ + Sbjct: 231 DVFVMLLSTALAYRFTQVTDRTQSM 255 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 52 FSVNFCIGEVYQNGQTYQKGWN--YWQ 126 F+ N+ + Y N YQ+G++ Y+Q Sbjct: 211 FNFNYQYNQAYSNYNNYQEGFSCQYYQ 237 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 52 FSVNFCIGEVYQNGQTYQKGWN--YWQ 126 F+ N+ + Y N YQ+G++ Y+Q Sbjct: 231 FNFNYQYNQAYSNYNNYQEGFSCQYYQ 257 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 125 KYGTR-YGASLRKMVKKMEVTQHAKYTCSFCGK 220 KY R + S ++ + T Y+C CGK Sbjct: 83 KYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,004 Number of Sequences: 336 Number of extensions: 3145 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -