BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N16 (934 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 29 7.1 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 28 9.4 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 153 KRDAPKEDNSLNTLAESAKKTIEELREKVESALAPETVKK 272 KRDAP DN S KK L +E+ +P + K Sbjct: 780 KRDAPLRDNDEQFRTYSRKKQHASLESSIEAPCSPRSASK 819 >SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) Length = 721 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 153 KRDAPKEDNSLNTLAESAKKTIEELREKVE 242 KR APK+ N+ + L +K EELR++ + Sbjct: 62 KRQAPKDRNTASVLRAKIRKQEEELRKETQ 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,133,390 Number of Sequences: 59808 Number of extensions: 287792 Number of successful extensions: 767 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -