BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N14 (899 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 6e-22 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 4e-16 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 81 9e-16 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 69 4e-12 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 64 2e-10 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 64 2e-10 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 47 2e-05 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 46 3e-05 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 45 7e-05 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 44 1e-04 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 44 2e-04 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 43 3e-04 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 42 5e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 42 9e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 41 0.001 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 41 0.001 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 41 0.002 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 41 0.002 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 41 0.002 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 41 0.002 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 41 0.002 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 41 0.002 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 41 0.002 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 41 0.002 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.002 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 41 0.002 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 41 0.002 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 41 0.002 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 0.002 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 41 0.002 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 41 0.002 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 41 0.002 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 41 0.002 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 41 0.002 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 41 0.002 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 41 0.002 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 41 0.002 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 41 0.002 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 41 0.002 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 41 0.002 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 41 0.002 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 41 0.002 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 41 0.002 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 41 0.002 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 41 0.002 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 41 0.002 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 41 0.002 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 41 0.002 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 41 0.002 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 41 0.002 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 41 0.002 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 41 0.002 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 41 0.002 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 41 0.002 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 41 0.002 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 41 0.002 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 41 0.002 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 41 0.002 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 41 0.002 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 41 0.002 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 41 0.002 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 41 0.002 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 41 0.002 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 41 0.002 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 41 0.002 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 41 0.002 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 41 0.002 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 41 0.002 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 41 0.002 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 41 0.002 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 41 0.002 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 41 0.002 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 41 0.002 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 41 0.002 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 41 0.002 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 41 0.002 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 41 0.002 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 41 0.002 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 41 0.002 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 41 0.002 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 41 0.002 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 41 0.002 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 41 0.002 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 41 0.002 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 41 0.002 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 41 0.002 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 41 0.002 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 41 0.002 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 41 0.002 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 41 0.002 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 41 0.002 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 41 0.002 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 41 0.002 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 41 0.002 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 41 0.002 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 41 0.002 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 41 0.002 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 41 0.002 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 41 0.002 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 41 0.002 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 41 0.002 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 41 0.002 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 41 0.002 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 41 0.002 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 41 0.002 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 41 0.002 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 41 0.002 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 41 0.002 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 41 0.002 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 41 0.002 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 41 0.002 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 41 0.002 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 41 0.002 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 41 0.002 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 41 0.002 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.002 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 41 0.002 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 41 0.002 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 41 0.002 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32638| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 101 bits (243), Expect = 6e-22 Identities = 49/58 (84%), Positives = 49/58 (84%) Frame = -2 Query: 547 SGGAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 SGG YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 23 SGGGA-YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 759 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 555 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 23 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 101 bits (242), Expect = 8e-22 Identities = 47/56 (83%), Positives = 47/56 (83%) Frame = -2 Query: 541 GAEPYGKXPAXRXFXGSWPXAGLLLTCSFLRYXLILWITVLPPLSELIPLAAAERP 374 G YGK PA R F GSWP AGLLLTCSFLRY LILWITVLPPLSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 82.6 bits (195), Expect = 4e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 81.4 bits (192), Expect = 9e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 287 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE 394 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE 135 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 81.4 bits (192), Expect = 9e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 287 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE 394 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGE 499 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 81.0 bits (191), Expect = 1e-15 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 542 GGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 81.0 bits (191), Expect = 1e-15 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 542 GGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 GG +LWK AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 59 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 539 GGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G +LWK AS AAF F+A CWPFAHMF+PALSPDSVDN ITAF Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAF 44 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.1 bits (169), Expect = 6e-13 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = -1 Query: 557 GMLVRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G V GG +LWK AS AAF F+A WPFAHMFF ALSPD VDN ITAF Sbjct: 12 GGQVSGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 71.3 bits (167), Expect = 1e-12 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = -1 Query: 548 VRGGGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 +RG + K AS AAF F+A CWPFAHMFFPALSPDSVDN ITAF Sbjct: 16 IRGAEPM-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 539 GGALWKXASXAAFXXFVAXCWPFAHMFFPALSPDSVDNXITAF 411 G +LWK AS AAF F+A CWPF HMF PALSPDSVD ITAF Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAF 44 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 63.7 bits (148), Expect = 2e-10 Identities = 34/63 (53%), Positives = 37/63 (58%) Frame = +2 Query: 437 NQXITQERTCEQKASXRPRTXKXPXXWRFSIGLRPP*XASXKSTXKSDVAKPXXDYKHTS 616 NQ ITQERTCEQKAS RP T K P WRFSIG P + K + + DYK T Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIG-SAPLTSITKIDAQVRGGETRQDYKDTR 144 Query: 617 RFP 625 RFP Sbjct: 145 RFP 147 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 63.7 bits (148), Expect = 2e-10 Identities = 34/63 (53%), Positives = 37/63 (58%) Frame = +2 Query: 437 NQXITQERTCEQKASXRPRTXKXPXXWRFSIGLRPP*XASXKSTXKSDVAKPXXDYKHTS 616 NQ ITQERTCEQKAS RP T K P WRFSIG P + K + + DYK T Sbjct: 115 NQGITQERTCEQKASKRPGTVKRPRCWRFSIG-SAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 617 RFP 625 RFP Sbjct: 174 RFP 176 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/75 (38%), Positives = 34/75 (45%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM*AKGQXKATNX 498 GGLRIG HSKAVI LSTESGDNAGKN+ + Q + + Sbjct: 309 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNISCEIQLFSVHQ 368 Query: 499 KXAAXLAXFHRAPPP 543 K L + PP Sbjct: 369 KSVTKLDTIVTSTPP 383 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 6/46 (13%) Frame = +3 Query: 216 KQVNNNNCIHFMFQVQGEVW------EVFSALMNRPTRGERRFAYW 335 + ++ N C+ F GE++ V +ALMNRPTRGERRFAYW Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYW 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 183 ICDTGYIPLPRSLTRYARSFDCGE 206 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = +1 Query: 313 GRGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 G GGLRIG HSKAVI LSTESGDNAGKNM Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = +1 Query: 301 GQRAGRGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 G G GGLRIG HSKAVI LSTESGDNAGKN+ Sbjct: 30 GTYTGGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/50 (50%), Positives = 26/50 (52%) Frame = +1 Query: 316 RGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 RGGLRIG HSKAVI LSTESGDNAGKN+ Sbjct: 262 RGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKNM Sbjct: 575 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKNM Sbjct: 7 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 55 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKNM Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKNM Sbjct: 140 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = +3 Query: 192 FVTIISCNKQVN--NNNCIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 335 F +I++ + N N C +M V V V +ALMNRPTRGERRFAYW Sbjct: 51 FCSILAPEIETNFSTNRCRRYMATVGKPV--VPAALMNRPTRGERRFAYW 98 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGE 157 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM*AK 474 GGLRIG HSKAVI LSTESGDNAGKN+ A+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNIDAE 53 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKN+ Sbjct: 448 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 496 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/49 (48%), Positives = 25/49 (51%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM 465 GGLRIG HSKAVI LSTESGDNAGKN+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAGKNI 50 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = +1 Query: 319 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKN 462 GGLRIG HSKAVI LSTESGDNAGKN Sbjct: 254 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 210 CNKQVNNNNCI--HFMFQVQGEVWEVFSALMNRPTRGERRFAYW 335 C ++NN N + + + V V +ALMNRPTRGERRFAYW Sbjct: 37 CTLELNNMNTLTEYVILSVVVGKPVVPAALMNRPTRGERRFAYW 80 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +3 Query: 159 FICEICDAIALFVTIISCNKQVNNNNCIHFMFQVQGEVWE---VFSALMNRPTRGERRFA 329 F+C + ++ + I CN ++ + FM + + V +ALMNRPTRGERRFA Sbjct: 172 FVCNMLLSMGTMLLFI-CNMMLSMGTMLLFMCNMLLSMVGKPVVPAALMNRPTRGERRFA 230 Query: 330 YW 335 YW Sbjct: 231 YW 232 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 5/44 (11%) Frame = +3 Query: 219 QVNNNNCIHFMFQVQ---GEVWE--VFSALMNRPTRGERRFAYW 335 +++NNN I + V G V + V +ALMNRPTRGERRFAYW Sbjct: 42 ELDNNNTIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 85 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGE 144 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 2/87 (2%) Frame = +3 Query: 81 G*LDPDMIRYIDEFGQTTTRMQ*KKCFICEICDAIALFVTIISCNKQVNNNNCIHFMFQV 260 G ++ ++ +Y+ ++ +T + + I + A + + N + N ++ + Q Sbjct: 54 GAIEMELSKYLRDYSRTIAGKE--QLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQK 111 Query: 261 QGEVWE--VFSALMNRPTRGERRFAYW 335 +V + V +ALMNRPTRGERRFAYW Sbjct: 112 HFQVGKPVVPAALMNRPTRGERRFAYW 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGE 197 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 5/50 (10%) Frame = +3 Query: 201 IISCNKQVNNNNCIHFMFQVQ---GEVWE--VFSALMNRPTRGERRFAYW 335 I + NK ++ NN I + V G V + V +ALMNRPTRGERRFAYW Sbjct: 1648 IQASNKMLSINNKIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 1697 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/40 (57%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +3 Query: 222 VNNNNCIHF--MFQVQGEVWEVFSALMNRPTRGERRFAYW 335 + CI F +F+V V V +ALMNRPTRGERRFAYW Sbjct: 124 IKRQPCISFTRIFRVGKPV--VPAALMNRPTRGERRFAYW 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 197 ICDTGYIPLPRSLTRYARSFDCGE 220 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 41.5 bits (93), Expect = 9e-04 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Frame = +3 Query: 213 NKQVNNNNCIHFMFQVQG-EVWE--VFSALMNRPTRGERRFAYW 335 N Q+ + +H +F +G V + V +ALMNRPTRGERRFAYW Sbjct: 161 NDQIISGLRLHNLFYRKGIRVGKPVVPAALMNRPTRGERRFAYW 204 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +3 Query: 210 CNKQVNNNNCIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 335 C ++ N+ + +F+ G+ V +ALMNRPTRGERRFAYW Sbjct: 21 CRNSIDIND-MKQLFECVGKP-VVPAALMNRPTRGERRFAYW 60 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGE 119 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 41.5 bits (93), Expect = 9e-04 Identities = 24/55 (43%), Positives = 27/55 (49%) Frame = +1 Query: 322 GLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIXLSTESGDNAGKNM*AKGQXK 486 GLRIG HSKAVI LSTESGDNAGKN+ + + K Sbjct: 210 GLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNICLEDELK 264 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 276 EVFSALMNRPTRGERRFAYW 335 +V +ALMNRPTRGERRFAYW Sbjct: 5 DVPAALMNRPTRGERRFAYW 24 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF C E Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCRE 83 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 5/46 (10%) Frame = +3 Query: 213 NKQVNNNNCIHFMFQVQ---GEVWE--VFSALMNRPTRGERRFAYW 335 N +VN ++ I + V G V + V +ALMNRPTRGERRFAYW Sbjct: 111 NHEVNESDFIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 156 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 240 IHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 335 +++ F G+ V +ALMNRPTRGERRFAYW Sbjct: 36 LYYAFSYVGKP-VVPAALMNRPTRGERRFAYW 66 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGE 125 >SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFNCGE 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +3 Query: 237 CIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 335 C + QV V V +ALMNRPTRGERRFAYW Sbjct: 189 CCTTLLQVGKPV--VPAALMNRPTRGERRFAYW 219 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 255 ICDTGYIPLPRSLTRYARSFDCGE 278 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGE 120 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 121 AALMNRPTRGERRFAYW 137 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGE 195 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGE 120 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGE 319 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGE 157 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGE 144 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGE 169 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 154 AALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGE 126 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGE 156 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGE 274 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGE 116 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGE 115 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGE 416 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGE 271 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGE 171 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGE 157 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGE 634 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 271 AALMNRPTRGERRFAYW 287 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGE 390 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGE 120 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGE 233 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGE 191 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGE 155 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGE 117 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGE 156 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 476 AALMNRPTRGERRFAYW 492 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGE 202 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGE 160 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 5505 AALMNRPTRGERRFAYW 5521 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGE 176 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGE 86 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGE 136 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGE 623 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 162 AALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGE 136 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 648 AALMNRPTRGERRFAYW 664 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGE 194 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGE 120 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 169 AALMNRPTRGERRFAYW 185 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGE 140 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGE 162 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGE 139 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGE 128 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 54 AALMNRPTRGERRFAYW 70 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGE 155 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 357 AALMNRPTRGERRFAYW 373 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGE 153 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGE 122 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGE 260 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGE 651 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGE 373 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGE 120 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGE 146 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGE 877 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 581 AALMNRPTRGERRFAYW 597 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 137 AALMNRPTRGERRFAYW 153 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGE 262 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGE 161 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGE 562 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGE 107 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 145 AALMNRPTRGERRFAYW 161 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGE 1007 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGE 133 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGE 175 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGE 512 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGE 116 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGE 145 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 424 AALMNRPTRGERRFAYW 440 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGE 308 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 240 AALMNRPTRGERRFAYW 256 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 200 AALMNRPTRGERRFAYW 216 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 143 AALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 752 AALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGE 127 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGE 97 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 117 AALMNRPTRGERRFAYW 133 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGE 217 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGE 302 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGE 128 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGE 176 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 136 AALMNRPTRGERRFAYW 152 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGE 136 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 178 AALMNRPTRGERRFAYW 194 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGE 178 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGE 83 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGE 146 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 115 AALMNRPTRGERRFAYW 131 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGE 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGE 100 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGE 115 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGE 155 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGE 124 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGE 1018 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGE 165 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGE 498 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR AR+F CGE Sbjct: 105 ICDTGYIPLPRSLTRYARTFDCGE 128 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGE 180 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 183 AALMNRPTRGERRFAYW 199 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGE 546 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGE 153 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGE 544 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGE 166 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGE 124 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGE 124 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGE 168 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGE 175 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGE 314 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 150 AALMNRPTRGERRFAYW 166 >SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 77 AALMNRPTRGERRFAYW 93 >SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGC 388 +C G +PLPRSLTR ARSF C Sbjct: 60 ICDTGYIPLPRSLTRYARSFDC 81 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 285 SALMNRPTRGERRFAYW 335 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 Query: 323 VCVLGALPLPRSLTRCARSFGCGE 394 +C G +PLPRSLTR ARSF CGE Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGE 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,763,580 Number of Sequences: 59808 Number of extensions: 285059 Number of successful extensions: 1897 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1894 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -