BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N13 (956 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 56 4e-08 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 46 5e-05 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 45 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 1e-04 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 44 2e-04 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 42 0.001 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 41 0.001 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 41 0.002 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 40 0.003 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 40 0.004 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 39 0.005 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 38 0.012 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.014 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.016 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.020 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.021 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 37 0.028 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 37 0.028 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 36 0.037 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 36 0.049 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 36 0.064 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 35 0.085 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 35 0.085 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 35 0.085 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 35 0.085 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 35 0.085 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 35 0.085 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.085 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.098 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 35 0.11 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 34 0.15 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 34 0.15 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 34 0.15 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 34 0.20 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 34 0.20 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 34 0.20 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 0.21 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.34 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 33 0.34 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 33 0.45 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 33 0.45 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 33 0.45 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 32 0.60 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.60 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 32 0.60 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 28 0.72 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 28 0.79 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.79 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.79 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 32 0.79 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 32 0.79 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 31 1.4 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 31 1.4 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 31 1.4 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 1.4 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 31 1.8 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.8 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 1.8 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 31 1.8 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.8 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.8 SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.8 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 30 2.4 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 30 2.4 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 30 3.2 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 30 3.2 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 30 3.2 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 30 3.2 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 30 3.2 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 4.2 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 4.2 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 4.2 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 29 4.2 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 29 4.2 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 29 4.2 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 5.6 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 5.6 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 24 5.9 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 29 7.4 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 7.4 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 29 7.4 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 7.4 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 7.4 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 28 9.7 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 28 9.7 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) 28 9.7 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 28 9.7 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 9.7 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 28 9.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPP-XPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P P PP PPPP P PPPP P P PPP AP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 422 PPXXPP 439 PP PP Sbjct: 425 PPPPPP 430 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP P P PPP PP P PP P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P+ PPP P P PPP P P PP P PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP +P P P P PP P PP P PP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP P P P P PP P PP P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP--XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP P P PPP PP P PP P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P PPP P P PP PP P PP P PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P P P P P PPP PP P PP P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP----PPPPPPPPPPP 418 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PP P P PP PP P PP P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP PP P P PPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP PP P P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP PP P P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P PPPP PPP + PP P P PPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 404 APXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 +P P PPP PP P PP P PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP P PP PPP PP P P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPP PPP PP P P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 50.8 bits (116), Expect = 2e-06 Identities = 33/103 (32%), Positives = 33/103 (32%), Gaps = 7/103 (6%) Frame = +2 Query: 245 PXPXPPXPPPPXXX--PXXXXXXXXXXXAXXXXXXXXXXXPPP--PXPXPAXXPPPXAP- 409 P P PP PPPP P A PPP P P P PPP P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Query: 410 --XPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PPP PP P PP P PP P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 49.6 bits (113), Expect = 4e-06 Identities = 32/96 (33%), Positives = 32/96 (33%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P A PPP P P P P AP P PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP---PSPNAPYP-PP 151 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PPN P PP P Sbjct: 152 PNPPYPPPLYPPPPNPP--PPNAPYPPPPYPPPPNP 185 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXX--PXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP-XP 415 P P PP PPPP P A PPP P P PPP AP P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Query: 416 XPPPXXP 436 PPP P Sbjct: 233 YPPPPNP 239 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/94 (30%), Positives = 29/94 (30%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP PPPP P P P P P P PP Sbjct: 126 PPPNPPYPPPPNAP--YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYP--PPPYPP 181 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P PP P PN P PP Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPPP P PP P P A PPP P PP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 P P P PP Sbjct: 215 PNAPNPPYPPPPNAPNPPYPP 235 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPX--PAXXP--PPXAPX 412 P P P PPPP PPPP P P P PP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA 201 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PPP PP P PP P PP P Sbjct: 202 PNPPPPNPPYPPPPNAP--NPPYPPPPNAPNPPYPPPPNP 239 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 2/96 (2%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXP-PPXAPXPXPPP 427 P PP P P P PPPP P P P PP P PPP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGIPXXLXR-XPPXP 532 P P PN P PP P Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXP-GLPPNRGIPXXLXRXPPXP 532 P PP P P PPP P P PP PP P PPN P P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Score = 35.5 bits (78), Expect = 0.064 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P P P P P P PPP PP P PP P PP P Sbjct: 90 PNPPYPPPPYPPYPPPP-PYPPPPNPPYPPPPNAPYPPPPNPPYP--PPPNAPYPPSP 144 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP P PP P A PPPP P PA PPP P P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP-PLPAPPPPPAQPAPQPPPA 108 Query: 431 XP 436 P Sbjct: 109 PP 110 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/62 (38%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Frame = +2 Query: 359 PPPPXPX---PAXXPPP-XAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P PA PPP AP PPP PP P PP + P + PP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP----QPPP 107 Query: 527 XP 532 P Sbjct: 108 AP 109 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPX---PXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPPP PA PPP AP P PPP P P PP+ Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P P PPPP P A PPPP PA PPP P P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPA--PPPPPAQPAPQPPPAPPHFLP 114 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G G GGGG G G GG G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGG 850 Query: 258 GXGXG 244 G G G Sbjct: 851 GGGGG 855 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G G GGG G G GGGG G GGGG GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDG-GGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 246 G 244 G Sbjct: 829 G 829 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GGG G G GGGG G G G GG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Query: 255 XGXG 244 G G Sbjct: 836 FGDG 839 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G GGG G G GGGG G GGGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G G GGG G G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Query: 258 GXGXG 244 G G Sbjct: 841 GYADG 845 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGGG Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G GGG G G GGGG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G G GGGG Sbjct: 835 GFGDGGGYADGDGGGGGGGGGGGGGGG 861 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG GGG G G GGGG Sbjct: 834 GGFGDGGGYADGDGGGGGGGGGGGGGG 860 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP P A PPP P P PP P G G PGLP G P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNG-PKGPPGLPGPPGPP 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +2 Query: 362 PPPXPXPAXXP-PPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P P P PP P P P P PP G G P N G P Sbjct: 114 PPGPPGPQMPPGPPGLPGP-PGPAGPPGTNGELGPPGDVGPPGNPGGP 160 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIP 502 P PP P PP P P P PP PP G PGL N G P Sbjct: 115 PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNP 169 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIP 502 P PP P PP P AP P PP PP G PG N G P Sbjct: 285 PGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 339 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIP 502 P PP P PP P AP P PP PP G PG N G P Sbjct: 370 PGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 424 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIP 502 P PP P PP P AP P PP PP G PG N G P Sbjct: 455 PGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNP 509 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIP 502 P PP P PP P AP P PP PP G PG N G P Sbjct: 540 PGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNP 594 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPP P P P P P P P P G PG P +G P Sbjct: 38 PPPPPGP---PGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPP 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P P P P P P PP G G N G P Sbjct: 633 PPSPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGNP 679 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P P P P P P PP G G N G P Sbjct: 803 PPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNP 849 Score = 29.1 bits (62), Expect = 5.6 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 8/65 (12%) Frame = +2 Query: 362 PPPXPXP----AXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLP-PN--RGIPXXL-XR 517 PP P P PP P P PP G PGLP PN G P L Sbjct: 50 PPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDM 109 Query: 518 XPPXP 532 PP P Sbjct: 110 GPPGP 114 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 359 PP--PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PP P P PA P P P P P PP G G N G Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTG 923 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 P P PA P P P P P PP G G N G Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAG 668 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P P P P P PP G PG N G P Sbjct: 208 PPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 254 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 359 PP--PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PP P P PA P P P P P PP G G N G Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGNAG 753 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 359 PP--PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PP P P PA P P P P P PP G G N G Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAG 838 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P P PPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P P PPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P PPP P P PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P PPP P P PPP P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P P PP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPP 439 A PPP P P PPP PP Sbjct: 463 APPPPPPPPPPPPPPPPPP 481 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP 409 P P PP PPPP P PPPP P P PPP P Sbjct: 464 PPPPPPPPPPPPPPP----------------------PPPPPPPPPFPPPPPPTP 496 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG AG G G GG G GGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 258 GXGXG 244 G G G Sbjct: 1816 GMGGG 1820 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GA GGG AG GG G Sbjct: 1815 GGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGG-XXAGXGXGGGG 358 GG GGG G G G G AG G G GG Sbjct: 1808 GGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 1801 GGMAGGGGGMGGGGGGM-GGGGEGMG 1825 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GG G G GGGG Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G GGG G G GGG Sbjct: 1805 GGGGGMGGGGGGMGGG-GEGMGAAGGG 1830 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP--PPXXPPXXXXXGXXXGXPGLPPNRGIPXXL 511 PPPP P P+ PPP P P P PP PP P PP +P L Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/58 (39%), Positives = 24/58 (41%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP P P P P PP P PP R + L PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP--------PPPSPP-RPLAAKLPEPPPIP 252 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPP P + P PP P A P P P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPP-------SPSPPRPPPPPPPSPPRPLAAKLPEP-PPIPNMP 255 Query: 425 PXXPP 439 P PP Sbjct: 256 PTLPP 260 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLP 484 PPPP P P PPP P P PP PP G PG P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPV-QQSGAPGSP 725 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P P PPP P PPP P G G P + PP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPP 439 P P PPP P P PPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPP 698 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 392 PPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPP P P PPP PP P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P PPP P P PPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPP 700 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/81 (24%), Positives = 20/81 (24%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPP 742 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 P G G PGL P Sbjct: 743 PPGQLPGQQPGQAGGRPGLNP 763 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTP 533 PP PPPP PPP + PP S P +P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P+ PPP P PPP PP G P LPP G PP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPP--PPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA---PXP 415 P P PPPP A PPP P PPP P P Sbjct: 926 PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPP 985 Query: 416 XPPPXXPPXXXXXG 457 PPP PP G Sbjct: 986 PPPPPPPPPMRKLG 999 Score = 36.7 bits (81), Expect = 0.028 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = +2 Query: 362 PPPXPXPAXXPPPX--APXPXPPP--XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPX 529 PP P PPP AP P PPP P G P PP P PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 530 P*IXGGGKTXP 562 P GG P Sbjct: 974 PPPPGGSAPPP 984 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP A PPPP P P PP P P Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP-PGGSAPP--PGGGAP 971 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 P PP P PP Sbjct: 972 PLPPPPGGSAPPPPPPPPPPP 992 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF*XKFXX 584 PP PPP P A PP G P P GG PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPG------GNAPPPPPPPGGSAPPP------G 967 Query: 585 RGXPGXXPPXGG 620 G P PP GG Sbjct: 968 GGAPPLPPPPGG 979 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 982 PPPPPPPPPPPP 993 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 983 PPPPPPPPPPPP 994 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG G G G G GGG G G GGGG G GGGG G Sbjct: 159 GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG---GGGGYG 215 Query: 258 GXGXG 244 G G G Sbjct: 216 GGGYG 220 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G G GGGG G GGG G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGG---YGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 225 Query: 258 GXG 250 G G Sbjct: 226 GGG 228 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GGG G G GGGG G GGGG GG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGG---YGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Query: 255 XGXG 244 G Sbjct: 222 GRSG 225 Score = 37.1 bits (82), Expect = 0.021 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GGG G G GGG +G G GGG G GGGG Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGY---RGRGRGGGGYGGGGYGGGGY 181 Query: 261 GGXGXG 244 GG G G Sbjct: 182 GGGGHG 187 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G GGG G G GG G GG G GG G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Query: 246 G 244 G Sbjct: 184 G 184 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = -3 Query: 399 GGGXXAGXGXG---GGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGXG 244 GGG G G G GGG G GGGG GG G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP* 535 PPP P P PPP P P PP P PG PPN IP PP Sbjct: 63 PPPNTPIPGD-PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGD---PPPNTP 118 Query: 536 IXGGGKTXPLLXXI 577 I G T PL I Sbjct: 119 IQGDPLTIPLFQGI 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP 532 PPP P P PPP P P PP P PG PPN IP P P Sbjct: 53 PPPNIPIPGN-PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIP 110 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP 532 PP P P PPP P P PP P PG PPN IP P P Sbjct: 44 PPNTPIPGD-PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIP 100 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP 532 PPP PP P P PP P PG PPN IP P P Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIP 90 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP 532 PPP PPP P P P PG PPN IP P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIP 80 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG-LPPNRGIPXXLXRXPPXP 532 PPP PPP P PP PG PPN IP P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIP 70 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP +P P PPP PP Sbjct: 1157 PPPPPPPPP--PPPSSPSPPPPPPPPP 1181 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P+ PP P P PPP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P P PPP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P P P PPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPT 491 PP PPPP PPP PPT Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 Score = 25.4 bits (53), Expect(2) = 0.97 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 1171 PSPPPPPPPPP 1181 Score = 24.6 bits (51), Expect(2) = 0.97 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 1174 PPPPPPPPPPPTP 1186 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IX 541 PPP A PPP P PPP PP G P PP P PP P I Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP----PPGRGAPPPGPMIP 410 Query: 542 G 544 G Sbjct: 411 G 411 Score = 36.3 bits (80), Expect = 0.037 Identities = 31/108 (28%), Positives = 32/108 (29%), Gaps = 4/108 (3%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP A PPP Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMA--PPPVGGAAP 363 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXP 562 PPP PP P PP G P PP P G G P Sbjct: 364 PPPPPPPVGGPP------PPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 33.9 bits (74), Expect = 0.20 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 6/64 (9%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP----XXPPXXXXXGXXXGXPGLPPNRGI--PXXLXRX 520 PPPP A PPP P PPP PP G P PP+R P R Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP--PPSRSSQRPPPPSRG 344 Query: 521 PPXP 532 P P Sbjct: 345 APPP 348 Score = 33.1 bits (72), Expect = 0.34 Identities = 22/79 (27%), Positives = 26/79 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 PPPP + PPP A PP PP PP+RG P P + Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP------PPSRGAPPPPSMGMAPPPV 358 Query: 539 XGGGKTXPLLXXIFXKGPP 595 G P + PP Sbjct: 359 GGAAPPPPPPPPVGGPPPP 377 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG--LPPNRGI 499 PPPP P PPP P PP G PG +P G+ Sbjct: 367 PPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPGRAGL 415 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/63 (34%), Positives = 26/63 (41%), Gaps = 5/63 (7%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP--XPPPXXPPXXXXXGXXXGXPGLPPNR---GIPXXLXRXP 523 P P P PPP P P PPP PP PG+PP G+P + + P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPP 296 Query: 524 PXP 532 P P Sbjct: 297 PPP 299 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPP P PPP P P PP P PP Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP-PGGMPPNMEQPPPPP 299 Query: 425 P 427 P Sbjct: 300 P 300 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P P PP PP PG PP G+P PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPP-MGMPGMGGMPPP 277 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXP----PPPXPXPAXXPPPXAPX 412 P P PP PPPP P PPP P PPP P Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 413 PXPPP 427 P PPP Sbjct: 976 PPPPP 980 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/89 (30%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA---PXP 415 P P P PPPP P P PP P A PP A P P Sbjct: 911 PLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPP 970 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP PP P LPP +P Sbjct: 971 PLPPLPPPPPPV--QTTTAPTLPPASCMP 997 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/64 (29%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP----PPXXPPXXXXXGXXXGXPGLPPNRGIPXXL--XRX 520 PPPP P PPP P P P P P PP +P + + Sbjct: 908 PPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQV 967 Query: 521 PPXP 532 PP P Sbjct: 968 PPPP 971 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P PPP PP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPP 924 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 7/96 (7%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA-------PXPXPP 424 PPP P A PPPP P PPP A P P Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTP 367 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP G G G PP P + PP P Sbjct: 368 VQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPP 403 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/60 (30%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPX----PXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PPP + P PPP PP P +PP + P + PP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNM------APSIPPWQTTPGYIPPPPP 429 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 7/68 (10%) Frame = +2 Query: 245 PXPXPPX-------PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX 403 P P PP PPPP P A PPPP P P PPP Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPI 210 Query: 404 APXPXPPP 427 PPP Sbjct: 211 LELAAPPP 218 Score = 36.3 bits (80), Expect = 0.037 Identities = 22/79 (27%), Positives = 26/79 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 P P P+ PPP +P PP PP G P + P G P PP P Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP-----PPPPPIA 171 Query: 539 XGGGKTXPLLXXIFXKGPP 595 P + PP Sbjct: 172 PAATVPAPAVPLAAASPPP 190 Score = 35.1 bits (77), Expect = 0.085 Identities = 22/91 (24%), Positives = 23/91 (25%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P PPPP P PPP P PPP P PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 440 XXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P +P P PP P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPP 198 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 7/72 (9%) Frame = +2 Query: 245 PXPXPPX-------PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX 403 P P PP PPPP P A P P P A PPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATV------PAPAVPLAAASPPPP 191 Query: 404 APXPXPPPXXPP 439 + P PPP PP Sbjct: 192 SGGPPPPPPPPP 203 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP P P+ PPP P P PP Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Query: 425 PXXP 436 P P Sbjct: 206 PPPP 209 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 420 PPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P P PPP PPT + P GG PPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 28.3 bits (60), Expect = 9.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXPPXX 445 PPPP P A PPPP A P P P P P Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPP----PPPPIAPAATVPAPAVPLAAASPPPP--- 191 Query: 446 XXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 G P PP P PP P Sbjct: 192 -SGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G G GGGG G GGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGG---------------GGGGGGGGGGGGGGGGAG 703 Query: 258 GXGXG 244 G G G Sbjct: 704 GAGAG 708 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 685 GGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG AG G G Sbjct: 684 GGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GA G G AG G G Sbjct: 691 GGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GG AG G G Sbjct: 689 GGGGGGGGGGGGGAGGAGAGAGDDDG 714 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GG G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPX-APXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP P PPP P P PPP P P PP G P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PPPP P PPP P PPP PP G PP+ G Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG-PPSEG 418 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P PPP P PPP PP G PP P PP P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP----PPPPTNGPPPP 407 Score = 35.9 bits (79), Expect = 0.049 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX--APXPX 418 P PP PPPP PPPP P PPP P P Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPP-PPPPTNGPPPPPPPTNGPPPPP 408 Query: 419 PPPXXPPXXXXXG 457 PP PP G Sbjct: 409 PPTNGPPSEGKCG 421 Score = 35.1 bits (77), Expect = 0.085 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P PPP P PPP G P PP P PP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP----PPPPP 400 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 6/64 (9%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP----PXPXPA--XXPPPXAPXPXPPP 427 PPPP P PPP P P P PPP P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 428 XXPP 439 PP Sbjct: 407 PPPP 410 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP--XPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP PPP P PPP P P PP G P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP 395 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF*XKFXX 584 PP PP PPP PP + P P G PPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP--PPTNGPPPPPPPTNGPPPPP----PPT 401 Query: 585 RGXPGXXPPXGGXPEK 632 G P PP G P + Sbjct: 402 NGPPPPPPPTNGPPSE 417 Score = 25.4 bits (53), Expect(2) = 8.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 359 PPPPXPXPAXXPP 397 PPPP P P+ PP Sbjct: 77 PPPPPPPPSSGPP 89 Score = 21.4 bits (43), Expect(2) = 8.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P P PPPP P Sbjct: 72 PSTPAPPPPPPPP 84 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GG G GGGG G Sbjct: 300 GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Query: 258 GXGXG 244 G G Sbjct: 360 SGGCG 364 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GG G GGGG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 303 Query: 258 GXGXG 244 G G G Sbjct: 304 GGGGG 308 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G G G GGGG Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVT 345 Query: 258 GXGXG 244 G G G Sbjct: 346 GGGGG 350 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G GG G G GGG GGG GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 255 XG 250 G Sbjct: 299 GG 300 Score = 32.3 bits (70), Expect = 0.60 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGX-GAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GGG G G GG G G GGG G GGGG Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGG-GGATGGGVGATGGGGGATGGGGGVTGGGGGA 351 Query: 261 GGXGXG 244 G G G Sbjct: 352 TGGGGG 357 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 38.3 bits (85), Expect = 0.009 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 2/96 (2%) Frame = +2 Query: 245 PXPXPPXP--PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P P P P PPP PPP P P PPP AP P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPR 540 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P +PP G P R PP Sbjct: 541 VPPPGAPHPRVPPPGASHPRVPP-PGAPH--PRVPP 573 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 2/96 (2%) Frame = +2 Query: 245 PXPXPPXP--PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P P P P PPP PPP P P PPP AP P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPR 490 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P +PP G P R PP Sbjct: 491 VPPPGAPHQRVPPPGAPHPRVPP-PGAPH--PRVPP 523 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/83 (30%), Positives = 25/83 (30%), Gaps = 2/83 (2%) Frame = +2 Query: 245 PXPXPPXP--PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P P P P PPP PPP P P PPP AP P Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV-PPPGAPHPK 600 Query: 419 PPPXXPPXXXXXGXXXGXPGLPP 487 PP P P LPP Sbjct: 601 VPPPGAPYQRLPYSGAYHPRLPP 623 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPP PP AP P PP P P +PP G P R PP Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPP-PGAPH--PRVPP 463 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP--XPPPXXPP 439 PP P P PP P P PPP PP Sbjct: 301 PPQYMPHPRMRPPTRIPPPGMGPPPRIPP 329 Score = 29.1 bits (62), Expect = 5.6 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 6/89 (6%) Frame = +2 Query: 245 PXPXPPXP--PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP----PXA 406 P P P P PPP PPP P P PP P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRV 581 Query: 407 PXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 P P P P PG P R Sbjct: 582 PPPGTPHPRVPPPGAPHPKVPPPGAPYQR 610 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP A PPP P PP PP G P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 33.5 bits (73), Expect(2) = 0.014 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PA P AP P PPP PP Sbjct: 83 PPPPPPPPASNVP--APPP-PPPVMPP 106 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P PPP + P PPP P Sbjct: 82 PPPPPP-----PPPASNVPAPPPPPP 102 Score = 23.0 bits (47), Expect(2) = 0.014 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 251 PXPPXPPPP 277 P PP PPPP Sbjct: 82 PPPPPPPPP 90 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP--AXXPPPXAPXP--- 415 P PP PPPP P PPPP P P A PPP P P Sbjct: 694 PPPPPPPPP---PLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGC 750 Query: 416 --XPPPXXP 436 PPP P Sbjct: 751 AGLPPPPPP 759 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP----AXXPPPXAPXPXPP 424 PP PP P PPPP P P PPP +P P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCA 737 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP G P PP +P Sbjct: 738 GLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +2 Query: 362 PPPXPXPAXXPPP--XAPXPXPPPXXPPXXXXXGXXXGXPGLPPN-RGIPXXLXRXPP 526 PPP P P PPP P PPP PP G P P G+P PP Sbjct: 694 PPPPPPP---PPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P + P PPP PP P PP P PP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP----PGCAGLPPPPP 730 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP--XPXPP 424 P PP PPPP P + PPPP P A PPP P P P Sbjct: 710 PMPPPPPPP---PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 31.9 bits (69), Expect = 0.79 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP--AXXPPPXAPXPX 418 P P PP PPPP PPPP P P A PPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLP-------PPPPPPPPGCAGLPPPPPPIDV 762 Query: 419 P 421 P Sbjct: 763 P 763 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/66 (28%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +3 Query: 417 PPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPK-XWGGEKPPPF*XKFXXRGX 593 PPPP PPP PP P +P+ G PPP G Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 594 PGXXPP 611 P PP Sbjct: 754 PPPPPP 759 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAG----XGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGG 271 GG GGG G G GG G G GGGG G GG Sbjct: 42 GGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Query: 270 GGXGGXG 250 GG GG G Sbjct: 102 GGSGGVG 108 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGG-GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXG 250 GG G G GGG G G GGG G G GGGG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGG-GGXG 259 G GGG G G GG AG G G GG G GG G Sbjct: 33 GVGGGGVGGGGGNGGG-AGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAA 91 Query: 258 GXGXG 244 G G G Sbjct: 92 GAGAG 96 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/105 (27%), Positives = 30/105 (28%), Gaps = 19/105 (18%) Frame = +2 Query: 245 PXPXPP-XPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXP--------- 394 P P PP PPPP P PPPP P P P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHS 161 Query: 395 ---------PPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP AP P PPP P P PP + P Sbjct: 162 VQLHASPPGPPPAPMPAPPPMVVPSHRHVFHHVTHPAPPPMQMAP 206 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 P P PPP P P PPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPP 117 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P A PPP P P PPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PP P PPP P P PPP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 PP PPP P P PPP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 P PA P AP P PPP PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPP 112 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P AP P PPP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAP 221 Score = 33.5 bits (73), Expect(2) = 0.020 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXG 457 PPPP P P P P P PP PP G Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNG 228 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 A P P A P PPP PP G P PP G P Sbjct: 185 ANKPSPMAGMPPPPPPPPPPGFPGG---APPPPPPPFGAP 221 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPP 424 PPP P P PPP A PP Sbjct: 211 PPPPPPPFGAPPPPALNGGPP 231 Score = 22.6 bits (46), Expect(2) = 0.020 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 245 PXPXPPXPPP 274 P P PP PPP Sbjct: 195 PPPPPPPPPP 204 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPP-PXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP P PA PP P P P P P G PGLP +GIP Sbjct: 1662 PPPPPP-PAPGPPGPDGPMGLPGPQGPDGPK---GPPGPPGLPGPQGIP 1706 Score = 29.5 bits (63), Expect = 4.2 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 4/72 (5%) Frame = +2 Query: 359 PPPPXPX-PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGL---PPNRGIPXXLXRXPP 526 P PP P P P P P P PP G PG PP R P PP Sbjct: 1670 PGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGP----MGPP 1725 Query: 527 XP*IXGGGKTXP 562 P GG+ P Sbjct: 1726 GP---SGGQGPP 1734 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/77 (27%), Positives = 21/77 (27%), Gaps = 1/77 (1%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP-PXAPXPXPPP 427 P PP PPPP P PP P P P P AP P Sbjct: 1660 PAPPPPPPPAPGP-PGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGR 1718 Query: 428 XXPPXXXXXGXXXGXPG 478 P G PG Sbjct: 1719 DGPMGPPGPSGGQGPPG 1735 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/67 (28%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = +3 Query: 405 PPXXPPPPXPP-PXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF-*XKF 578 P P PP PP P + + P G P PK W G PP + Sbjct: 1793 PKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAY 1852 Query: 579 XXRGXPG 599 +G PG Sbjct: 1853 GWKGYPG 1859 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P PP P PPP A P PPP PP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +2 Query: 362 PPPXPXPAXXPPPXA---PXPXPPPXXPP 439 PPP PA PPP A P P PPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P PPP AP P PPP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAP 241 Score = 29.1 bits (62), Expect(2) = 0.50 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P PP P A PPP P P P Sbjct: 231 PAPPPPPAAAPPPPPPPPPVKKP 253 Score = 24.6 bits (51), Expect(2) = 8.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 241 PPPPPPPPPVKKP 253 Score = 22.2 bits (45), Expect(2) = 0.50 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P P PPPP Sbjct: 226 PPPAAPAPPPP 236 Score = 22.2 bits (45), Expect(2) = 8.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 237 PAAAPPPPPPP 247 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P P PPP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P P PPP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P P P P PPP P P PPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 32.3 bits (70), Expect(2) = 0.025 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PPPP P P PPP P P PP Sbjct: 867 PPPPPPPP---PPPPPPPPPPP 885 Score = 29.1 bits (62), Expect(2) = 0.20 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P PPP A P Sbjct: 871 PPPPPPPPPPPPPPPASSTGSTP 893 Score = 23.4 bits (48), Expect(2) = 0.025 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P P PPPP P Sbjct: 860 PRPRPRRPPPPPPPP 874 Score = 23.4 bits (48), Expect(2) = 0.20 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P P PPPP P Sbjct: 862 PRPRRPPPPPPPPPP 876 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 P PP P A P AP P PPP P G P PP PP P + Sbjct: 162 PQPPAPPAAPFMAPAAP-PAPPPPGAPAAPPAPPFGGPPSAPP----------PPPAPPV 210 Query: 539 XGGG 550 GGG Sbjct: 211 GGGG 214 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 36.7 bits (81), Expect = 0.028 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G GGGG G GGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGG---------------DGGGGGGGGDGGGGGGGG 109 Query: 258 GXGXG 244 G G G Sbjct: 110 GGGVG 114 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G GGGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G Sbjct: 344 GGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXG 367 GG GGG G G GGG + G G Sbjct: 349 GGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 35.9 bits (79), Expect = 0.049 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXG-GGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXG 250 GGG G GA GGG G G G GGG G GGG GG G Sbjct: 136 GGGEGNGA-GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Query: 249 XG 244 G Sbjct: 195 DG 196 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 156 GGGEGGWGGRGGNGGGR--GGGEGGGG 180 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG G G G G GG G G GGG Sbjct: 163 GGRGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXG--GGG 358 G GGG G G GGG G G G GGG Sbjct: 166 GGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G G G G GGG Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 174 GGEGGGGRGRGT-GGGSRGGGGDGRG 198 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 35.9 bits (79), Expect = 0.049 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP--PXAPXPXPP 424 P PP P P P P PP P A P P P PP Sbjct: 195 PSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPP 254 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIP 502 P P PPN IP Sbjct: 255 ATPNPFIPPASPNPSIPPAPPNPSIP 280 Score = 33.9 bits (74), Expect = 0.20 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 5/91 (5%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP-PPXPXPAXXP----PPXAP 409 P P P PP P PP P P P P PP +P Sbjct: 207 PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASP 266 Query: 410 XPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 P PP P P PPN IP Sbjct: 267 NPSIPPAPPNPSIPAPPNPSIPLAPPNPYIP 297 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 1/85 (1%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPX-PAXXPPPXAPXPXPPP 427 P PP P P P P PP P P P P P P P Sbjct: 280 PAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P PPN IP Sbjct: 340 SIPPAP----PNPSIPPAPPNLFIP 360 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPP-PXAPXPXPPPXXP--PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPX 529 P PP P PP P AP P P P P G P +PP + + PP Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP-APLHPHIPPAPPN 235 Query: 530 P 532 P Sbjct: 236 P 236 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P P P P P P PP P PPN IP PP P Sbjct: 272 PAPPNPSIPAPPNPSIPLAPPNPYIPPAP----PNLFIPSAPPNPHIPP----APPNP 321 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 35.9 bits (79), Expect = 0.049 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 8/72 (11%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA----PXPXPP----PXXPPXXXXXGXXXGXPGLPPNRGIPXXLX 514 P P P P PPP P P PP P PP G G PP G P Sbjct: 582 PTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQH 641 Query: 515 RXPPXP*IXGGG 550 PP G G Sbjct: 642 PPPPPAGYPGYG 653 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GGG G GGGG + G GG G G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 Query: 258 GXG 250 G Sbjct: 821 SGG 823 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GG G G GGG G G GGG Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGG 781 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGG 107 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFG 110 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGG 115 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGGG Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GG G Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGGG Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G G GG Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGG 111 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G GGGG Sbjct: 100 GFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGGG 358 G GGG G G GG G G G GGGG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGG 113 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 35.1 bits (77), Expect = 0.085 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G GGGG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGG 103 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 82 GGCGGGGGGGGGVGGG---GGGGGGGG 105 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G GGGG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGG 101 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G G GGGG Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGG 102 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG GGG Sbjct: 87 GGGGGGGVGGGGGGGGGGGDDCEDGGG 113 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G GG Sbjct: 113 GGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXG----GGG 358 GG GGG G G GGG G G G GGG Sbjct: 117 GGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGG Sbjct: 126 GGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 109 GGYGGGRGGGGYGGG-RGGGGYGGG 132 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GGG G G GGG Sbjct: 112 GGGRGGGGYGGGRGGGGYGG-GRGGG 136 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPXPX---PAXXPPPXAPXPXPPPXXPP 439 PPPP P P PP P P PPP PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P+ P P P P PP PP Sbjct: 564 PPPLP-PSEDPKPPPPPPEPPEECPP 588 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.1 bits (77), Expect = 0.085 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P PPPP PPP A PP L + P P GG PPP Sbjct: 656 PEAGPPPPPPPPPGGQ-----AGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 359 PPPPXPXP---AXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P A PP P P P PP G G P PP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIG--GGAPPPPP 704 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P A PPP PP PP Sbjct: 679 PPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +2 Query: 359 PPPPXPXP---AXXPPPXAPXPXPPPXXP 436 PPPP P P A PPP PPP P Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXP 562 P PPP PP G G P PP +P PP P GGG P Sbjct: 660 PPPPPPPPPG----GQAGGAPP-PPPPPLPGGAAPPPPPP--IGGGAPPP 702 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 35.1 bits (77), Expect = 0.085 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G GA GGG G G GG G GGGG Sbjct: 47 GGATGG--GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGAT 104 Query: 258 GXGXG 244 G G G Sbjct: 105 GGGGG 109 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GG G G GG Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGAT 118 Query: 258 GXGXG 244 G G G Sbjct: 119 GGGVG 123 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXA-GXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G GG G GA GGG A G G G G A G GGGG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 258 GXGXG 244 G G Sbjct: 111 TGGHG 115 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GGG G GGGG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGG 66 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GG Sbjct: 143 GGATGGGGGATGGGGGATGGGGGATGG 169 Score = 29.9 bits (64), Expect = 3.2 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGX-GAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GGG G G GG G G GG G GGGG Sbjct: 101 GGATGGGGGATGGHGGATGGGVG-ATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 261 GGXGXG 244 G G G Sbjct: 160 TGGGGG 165 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GG G Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYG 230 Score = 35.1 bits (77), Expect = 0.085 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 208 GGGYGGGRGGGGYGGG-HGGGGYGGGG 233 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXG 250 G G G+ GGG +G G G GG G GGGG GG G Sbjct: 176 GDSGGGGSQGGGYRSG-GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGGG Sbjct: 203 GGGSGGG-GYGGGRGGGGYGGGHGGGG 228 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GG G G GGGG Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGG 219 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXG--GGG 358 GG GGG G G GGG G G GGG Sbjct: 217 GGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -3 Query: 438 GGXXGG---GXGXGAXGGGXXAGXGXGGGG 358 GG GG G G G+ GGG G G GG G Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYG 221 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G GG Sbjct: 213 GGRGGGGYGGGHGGGGYGGGGRHDYGG 239 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 35.1 bits (77), Expect = 0.085 Identities = 24/71 (33%), Positives = 27/71 (38%), Gaps = 3/71 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP--XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP-X 529 PP P P P+ PPP P P P P PP PP G P + PP Sbjct: 433 PPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPG-GAPSPMGGGPPGG 491 Query: 530 P*IXGGGKTXP 562 P GG + P Sbjct: 492 PSGSPGGLSGP 502 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.1 bits (77), Expect = 0.085 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP--PXPXPAXXPPPXAPXPX 418 P P PP P + PPP P P P PPP P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPV 1085 Query: 419 PPPXXP 436 PPP P Sbjct: 1086 PPPRQP 1091 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P P PP P P P P PPP P P P Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPA 1114 Query: 425 P 427 P Sbjct: 1115 P 1115 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PPP P P P PP P PP + P + P P Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQ--PDPIPTNPAHP 1101 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP-PXP 532 PPP P P PP P P P PP P PP+ P R P P P Sbjct: 1042 PPPRKPSP---PPSAVPIPPPRKPSPPPSEPAPPPRQPP--PPSTSQPVPPPRQPDPIP 1095 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P PP P P P PP P PP+ P R PP P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP--PRQPPPP 1079 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PPP P P P P P PP + P + P P Sbjct: 1035 PPSAQPL--PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 35.1 bits (77), Expect = 0.085 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PPP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPX--PPPXXPP 439 PPP P P PPP AP PPP PP Sbjct: 189 PPPAP-PGVLPPPPAPPGALIPPPPAPP 215 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP 409 PPPP P A PPP AP Sbjct: 198 PPPPAPPGALIPPPPAP 214 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.1 bits (77), Expect = 0.085 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P A PPP AP P P P P P LPP P PP P Sbjct: 761 PPAPPQFAPVPPPCAPIP-PMPCSAPLPPAPAPFSAAPHLPP---APNISAEPPPPP 813 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 30.7 bits (66), Expect(2) = 0.098 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P PPP P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P AP PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +2 Query: 359 PPPPXPXPAXX--PPPXAPXPXPPPXXP 436 PPPP P A PP P P P P P Sbjct: 8 PPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 23.0 bits (47), Expect(2) = 0.098 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 251 PXPPXPPPP 277 P PP PPPP Sbjct: 5 PPPPPPPPP 13 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P PA PPP P P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALP 448 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP----AXXPPPXAPXPX 418 P PP PPPP P P PPP P P Sbjct: 374 PPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPPPAPL 433 Query: 419 PPPXXPP 439 PPP PP Sbjct: 434 PPPPPPP 440 Score = 31.9 bits (69), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPPP P P PPP P P Sbjct: 425 PPPPPPAPLPPPPPPPPQP 443 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP-XPXPPPXXPP 439 PPPP P P PPP P P P P Sbjct: 427 PPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P P PPP PP Sbjct: 1031 PPTPPPTEPPTPPPTEP-PTPPPTDPP 1056 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P PPP P P PPP PP Sbjct: 1023 PPTEPPTDPPTPPPTEP-PTPPPTEPP 1048 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 P P P PP P P PPP PP P PP + Sbjct: 1016 PDPLPTDPPTEPPTDP-PTPPPTEPPTPPPTEPPTPPPTDPPTQ 1058 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PP P P PP PP Sbjct: 1027 PPTDPPTPPPTEPP-TPPPTEPPTPPP 1052 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P P PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGG Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGGG 285 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 205 GGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GG G G GGG G G GGG Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGG 225 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G GG Sbjct: 209 GGRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGG--XGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G G GG Sbjct: 185 GGSQGGGYRSGGGGYGGSSRGGYGGGRGG 213 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 34.3 bits (75), Expect = 0.15 Identities = 27/86 (31%), Positives = 30/86 (34%), Gaps = 6/86 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP------XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRX 520 P PP P PP P PPP PP G P PP G P R Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFP--PPPFGPPPPFYRG 496 Query: 521 PPXP*IXGGGKTXPLLXXIFXKGPPR 598 PP P G P + +GPP+ Sbjct: 497 PPPP----RGMPPPPRQRMPSQGPPQ 518 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 365 PPXPXPA-XXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGL-PPNRGIPXXLXRXPP 526 PP P P P P PP PP G G+ PP RG P PP Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPP 491 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 395 PPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PP PP G G P LPPN P R P P Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGG--GPPQLPPNLPPPPGGMRGMPPP 471 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP PPP PP PP P PP R P L PP P Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPP-PPPISKPPTSTRSAPPPPPGRA-PQPLGGPPPPP 375 Score = 33.5 bits (73), Expect = 0.26 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 1/92 (1%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA-PXPXPPPXXP 436 P PPPP PPPP P PP P PPP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP---PISKPPTSTRSAPPPPPGRA 364 Query: 437 PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P G P PP R P PP P Sbjct: 365 PQ-----PLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 32.7 bits (71), Expect = 0.45 Identities = 25/98 (25%), Positives = 25/98 (25%), Gaps = 2/98 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP PP PA PP A P PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 322 Query: 425 PXXPPXXXXXGXXXG--XPGLPPNRGIPXXLXRXPPXP 532 P G P PP P PP P Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAP-XPXPPP 427 PPP P P PPP AP P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.3 bits (65), Expect = 2.4 Identities = 30/107 (28%), Positives = 32/107 (29%), Gaps = 16/107 (14%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXX--PPPPXPXP--AXXPPPXAPXPXPP- 424 P PPPP P + PPPP P PPP P PP Sbjct: 215 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 274 Query: 425 -----PXXPP--XXXXXGXXXGXPGLPPNR----GIPXXLXRXPPXP 532 P PP P LPP+R P L PP P Sbjct: 275 RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPP 321 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP PPP PPP P Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPP 220 Score = 28.3 bits (60), Expect = 9.7 Identities = 22/76 (28%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +3 Query: 405 PPXXPP-----PPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF* 569 PP PP P PPP PPT P+ GG PPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP-- 375 Query: 570 XKFXXRGXPGXXPPXG 617 PG PP G Sbjct: 376 --------PGRRPPSG 383 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 5/70 (7%) Frame = +2 Query: 245 PXPXPPX-----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP 409 P P PP PPPP PPPP P PP Sbjct: 329 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP---PGRRPPSGKI 385 Query: 410 XPXPPPXXPP 439 P PPP PP Sbjct: 386 NPPPPP--PP 393 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGG Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGG 330 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G GG G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 420 GXGXGAXGGGXXAGXGXGGGG 358 G G G GGG G G GGGG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGG 322 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G G G G GGG G G GGG Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGG 326 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP PPP PP PP P PP R P L PP P Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPP-PPPISKPPTSTRSAPPPPPGRA-PQPLGGPPPPP 287 Score = 33.5 bits (73), Expect = 0.26 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 1/92 (1%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA-PXPXPPPXXP 436 P PPPP PPPP P PP P PPP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP---PISKPPTSTRSAPPPPPGRA 276 Query: 437 PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P G P PP R P PP P Sbjct: 277 PQ-----PLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 32.7 bits (71), Expect = 0.45 Identities = 25/98 (25%), Positives = 25/98 (25%), Gaps = 2/98 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP PP PA PP A P PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 234 Query: 425 PXXPPXXXXXGXXXG--XPGLPPNRGIPXXLXRXPPXP 532 P G P PP P PP P Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Score = 30.3 bits (65), Expect = 2.4 Identities = 30/107 (28%), Positives = 32/107 (29%), Gaps = 16/107 (14%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXX--PPPPXPXP--AXXPPPXAPXPXPP- 424 P PPPP P + PPPP P PPP P PP Sbjct: 127 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 186 Query: 425 -----PXXPP--XXXXXGXXXGXPGLPPNR----GIPXXLXRXPPXP 532 P PP P LPP+R P L PP P Sbjct: 187 RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPP 233 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP PPP PPP PP P +R +P Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPP-PPGRGPSQRSLAPPPTGSSRPLP 153 Score = 28.3 bits (60), Expect = 9.7 Identities = 22/76 (28%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +3 Query: 405 PPXXPP-----PPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF* 569 PP PP P PPP PPT P+ GG PPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP-- 287 Query: 570 XKFXXRGXPGXXPPXG 617 PG PP G Sbjct: 288 --------PGRRPPSG 295 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 5/70 (7%) Frame = +2 Query: 245 PXPXPPX-----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP 409 P P PP PPPP PPPP P PP Sbjct: 241 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP---PGRRPPSGKI 297 Query: 410 XPXPPPXXPP 439 P PPP PP Sbjct: 298 NPPPPP--PP 305 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGGXGXGA--XGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G GGG G G GGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GG G GGGG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGG 125 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P PP P PP PP Sbjct: 430 PPPTPPPT-PPPTPPPTTLPPTTQPP 454 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA--PXPXPPP 427 PP P P P PPP P PPP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 28.7 bits (61), Expect(2) = 0.21 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXP 421 PPP P P PP P P P Sbjct: 438 PPPTPPPTTLPPTTQPPPQP 457 Score = 23.8 bits (49), Expect(2) = 0.21 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P PP PPP P Sbjct: 430 PPPTPPPTPPPTPPP 444 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 30.3 bits (65), Expect(2) = 0.34 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP 397 P PPPP P PPPP P P PP Sbjct: 1423 PAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCPPP 1468 Score = 21.4 bits (43), Expect(2) = 0.34 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 374 PXPAXXPPPXAPXPXPP 424 P P P P A P PP Sbjct: 1484 PSPVSAPLPMAAPPSPP 1500 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDG 65 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G A GGGG Sbjct: 53 GGGGGGGDGDGDGDGDANANADGGGGG 79 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 405 AXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGXG 244 A GGG G G GGGG G GGGG G G G Sbjct: 39 ADGGGGGGGGGGGGGG---GGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P P PPP P P PP P Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAP 160 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPP 147 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPX---PXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P PP P Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAP 152 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G GG Sbjct: 206 GGPRGGGGGSGGYGGGSYGGYGNYGG 231 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 PP P P PP P PP PP G PG+PP R Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPP----RGPMGPGPGMPPMR 445 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GG G G GGG G GGG G Sbjct: 337 GGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHG 396 Query: 258 GXGXG 244 G G Sbjct: 397 GGDYG 401 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G GG G G GGG G G GGG G GGG G Sbjct: 333 GDHGGGDPGGGDPGGGDPGG-GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHG 391 Query: 258 GXGXG 244 G G Sbjct: 392 GGDHG 396 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PPPP P P PPP A P P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P P PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPP 439 A PP AP P PPP PP Sbjct: 71 ATPPPLCAPPPPPPPPPPP 89 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPPXXXXXG 457 A PPP P PPP PP G Sbjct: 70 AATPPPLCAPPPPPPPPPPPPPPPG 94 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P PPP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PPP P P PPP P Sbjct: 54 PPPPPP-----PPPPPPPPPPPPSSSP 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PPPP P P PPP + P P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGG Sbjct: 85 GDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 87 GDGGGGGDGDGG-GGGDGGGGGDGGGG 112 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGG-XGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G G G G GGGG Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGG 100 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 70 GDDGGGDGGGCDGGG---GDGDGGGG 92 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGGG 358 G GGG G G GG G G G GGGG Sbjct: 79 GCDGGGGDGDGGGGGDGDGGGGGDGGGG 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG GGG G G G GG Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGG 104 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PPPP P P PPP A P P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P P PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPP 439 A PP AP P PPP PP Sbjct: 272 ATPPPLCAPPPPPPPPPPP 290 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 383 AXXPPPXAPXPXPPPXXPPXXXXXG 457 A PPP P PPP PP G Sbjct: 271 AATPPPLCAPPPPPPPPPPPPPPPG 295 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGG Sbjct: 100 GDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 102 GDGGGGGDGDGG-GGGDGGGGGDGGGG 127 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGG-XGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G G G G GGGG Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGG 115 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GGGG Sbjct: 85 GDDGGGDGGGCDGGG---GDGDGGGG 107 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGGG 358 G GGG G G GG G G G GGGG Sbjct: 94 GCDGGGGDGDGGGGGDGDGGGGGDGGGG 121 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG GGG G G G GG Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGG 119 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG GGG AG G GGGG Sbjct: 142 GMGGGGMAGEGMGGGGMAGEGMGGGG 167 Score = 31.9 bits (69), Expect = 0.79 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GGG G G G AG G GGGG A G G GG Sbjct: 40 GGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMA-GEGMGGGGMAGEGMGRGGI 98 Query: 261 GGXGXG 244 G G G Sbjct: 99 AGEGMG 104 Score = 31.9 bits (69), Expect = 0.79 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G AG G GGGG A G G GG G Sbjct: 82 GMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIA-GEGMGRGGMAGEGMGRGGMAG 140 Query: 255 XGXG 244 G G Sbjct: 141 EGMG 144 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -3 Query: 438 GGXXGGGXGXGAX-----GGGXXAGXGXGGGG 358 GG G G G G GGG AG G GGGG Sbjct: 126 GGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGG 157 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G+ G G G GGGG Sbjct: 434 GSAAGGGTGSGSTGNGNAGNGGAGGGG 460 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG G G G G G G G GGG Sbjct: 439 GGTGSGSTGNGNAGNGGAGGGGAGGG 464 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 32.3 bits (70), Expect = 0.60 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 PPP P P PPP P P PP PP P + P R P + P Sbjct: 168 PPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Query: 524 PXP 532 P Sbjct: 228 TTP 230 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PPP P P PP P +PP I + PP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP---IDPPRTQPPPIP 211 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXP-XPAXXPPPXAPXPXPPP 427 P PP PPPP PPPP P P P P P PPP Sbjct: 720 PPPPAPPPPPLGRDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARP--PPPPPPP 777 Score = 29.9 bits (64), Expect = 3.2 Identities = 23/94 (24%), Positives = 24/94 (25%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PPPP PPPP P P PP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPP---PPLGRDSAAVFML 740 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP +P R PP P Sbjct: 741 TWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPP 774 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.3 bits (70), Expect = 0.60 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 11/74 (14%) Frame = +2 Query: 251 PXPPXPPP--PXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXX--PPP------ 400 P PP PPP P P PP P PA PPP Sbjct: 246 PPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPN 305 Query: 401 -XAPXPXPPPXXPP 439 +P P PPP PP Sbjct: 306 FTSPSPPPPPPLPP 319 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/79 (26%), Positives = 22/79 (27%), Gaps = 4/79 (5%) Frame = +2 Query: 251 PXPPXPPP-PXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX---APXPX 418 P PP PPP P P + P P PP AP Sbjct: 309 PSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATL 368 Query: 419 PPPXXPPXXXXXGXXXGXP 475 P P PP G G P Sbjct: 369 PSPIMPPPPPMDGVDGGVP 387 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P PPPP PPP PPP P Sbjct: 281 PPPPPPPSNTP------------GMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Query: 437 P 439 P Sbjct: 329 P 329 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P+ P A PP PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPP 306 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 362 PPPXPXPAXXPP--PXAPXPXPPPXXPP 439 P P P P P P AP P PPP PP Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 362 PPPXPXPAXXP---PPXAPXPXPPPXXPPXXXXXG 457 PP P P P P AP PPP PP G Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPG 391 Score = 24.6 bits (51), Expect(2) = 8.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 378 PPPPPPPPPPPAP 390 Score = 22.2 bits (45), Expect(2) = 8.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 375 PFAPPPPPPPP 385 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 28.3 bits (60), Expect(2) = 0.72 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P PP P PPP P Sbjct: 519 PPPPLPAEEDNSPPPLP-AGPPPDEP 543 Score = 22.2 bits (45), Expect(2) = 0.72 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPP Sbjct: 511 PPPPPPASPPP 521 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 211 PPPPPPPPPPPP 222 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 212 PPPPPPPPPPPP 223 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 213 PPPPPPPPPPPP 224 Score = 25.4 bits (53), Expect(2) = 0.79 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 211 PPPPPPPPPPP 221 Score = 25.0 bits (52), Expect(2) = 0.79 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 392 PPPXAPXPXPPP 427 PPP P P PPP Sbjct: 213 PPPPPPPPPPPP 224 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P PPP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 P P P P P P P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRP 1380 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP P P P P P P PP P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P P P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 24.6 bits (51), Expect(2) = 8.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 69 PPPPPPPPPLPPP 81 Score = 22.2 bits (45), Expect(2) = 8.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 64 PPTLPPPPPPP 74 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P P P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 24.6 bits (51), Expect(2) = 8.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 293 PPPPPPPPPLPPP 305 Score = 22.2 bits (45), Expect(2) = 8.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 288 PPTLPPPPPPP 298 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP-PXXXXXG-XXXGXPGLPP 487 PP P PP P P PP P P G G PG+PP Sbjct: 366 PPMALSLPGMPPPGLLPPPGMPPRLPIPGLGLPGMPLPGMPGMPP 410 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPX--PPPXXPPXXXXXGXXXGXPGLP 484 PP P P P P PPP PP G G PG+P Sbjct: 362 PPGMPPMALSLPGMPPPGLLPPPGMPPRLPIPG--LGLPGMP 401 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPP P+ PP AP PPP P G PP+ Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPS 2217 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PP P P PP P PP PP G PP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PP P PP PP G PP+ P P P Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 P P P+ PP AP PPP P G PP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.9 bits (69), Expect = 0.79 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPPP P P PPP P P Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 374 PXPAXXPPPXAPXPXPPPXXPP 439 P + PPP P P PPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PP P P PPP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP 427 PP P P PPP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXP 436 PP P PPP P P P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G GGG G G GGG G G G Sbjct: 156 GGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYS 215 Query: 258 GXGXG 244 G G G Sbjct: 216 GGGGG 220 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G GGG Sbjct: 114 GGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GG G G GGG G G GG Sbjct: 109 GGSSRGGYGGGRGGGGYGGGRGGGG 133 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GGG G G GGGG Sbjct: 323 GGGGYGGGRGGGRGYGGGRGGGG 345 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G GG Sbjct: 118 GGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGG--XGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G G GG Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGG 122 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 374 PXPAXXPPPXAPXPXPPPXXP 436 P PA PPP P PPP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTP 116 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P PP P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGP 121 Score = 29.1 bits (62), Expect(2) = 0.83 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXG 457 PPPP P PP P P PP G Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCG 133 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 PPPP P PP P P P P G P R Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHTR 139 Score = 21.4 bits (43), Expect(2) = 0.83 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P P PPPP P Sbjct: 96 PPPATPPPPTMPP 108 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GG G G+ GGG G GGGG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGGG 206 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP 427 PPP P PA P P P P PPP Sbjct: 303 PPPPPLPAGVPAP--PPPPPPP 322 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA-P--XPXPPPXXPP 439 PPP PA PPP P P PPP PP Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPPP P PPP P P Sbjct: 304 PPPPLPAGVPAPPPPPPPP 322 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GG A G GGG Sbjct: 189 GASAGGGGGVGTTGGSTGAAGGGGGG 214 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PP P P P P PP Sbjct: 223 PPPGGMPPGRMPPQGLPFPPPGPIPPP 249 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPP 560 PP PP PPP PP G P P GG +PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGA-GGMRPP 258 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G G GGG Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGG 251 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PP P PPP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRP 1261 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP-PXXPP 439 P PP P P PPP P PP P PP Sbjct: 1261 PMPPQP-PFMPPPPRMQPPGPPGPPGPP 1287 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/56 (28%), Positives = 16/56 (28%), Gaps = 1/56 (1%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXP-PPXAPXPXP 421 PP P P P PPPP P P PP P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GGG G GGG Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGG 103 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GGG G GGG Sbjct: 87 GGCEGGGGCVGCEGGGGCVGCEGGGG 112 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GG A G GGG Sbjct: 235 GASAGGGGGVGTTGGSTGAAGGGGGG 260 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGGG Sbjct: 55 GGQGGGGQGGGQGVGGQEVG-GQGGGG 80 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P P P P PPP P Sbjct: 138 PPPPTP-PQSTPKPRRVLPTPPPKPP 162 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXP-AXXPPPXAPXPXPPPXXPP 439 PPP P P A PPP PPP PP Sbjct: 394 PPPLIPPPQASIPPPTMIQTLPPPSVPP 421 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 392 PPPXAPXPXPPPXXPP 439 PPP +P P PPP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 392 PPPXAPXPXPPPXXPP 439 PPP +P P PPP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP--XPXP-PPXXP--PXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 PPP P PPP AP P P PP P P P LPP L + P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPPLRQTP 515 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P PP P PP P G PG P P + PP P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSP----PATSPKQPPLP 502 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GG +G G GGGG Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGG 88 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GG G G GGG G GGG Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGG 468 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G G G G G GGG G G GGG Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGG 458 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G G G G G GG Sbjct: 446 GGGDGGGGGDGG-GDGIDGGDGGGDGG 471 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGGXGXGAXG--GGXXAGXGXGGGG 358 GG GGG G G GG G G G GG Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGGDGGGDGG 475 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP-PXXPP 439 PP P P PPP P PP P PP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPP 49 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXGGG 361 P G GGG G G GGG G G GGG Sbjct: 35 PGFSPRGAGRGGGRG-GPRGGGRGGGRGGGGG 65 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGG---XXAGXGXGGG 361 GG GGG G G GGG G G GGG Sbjct: 49 GGPRGGGRGGGRGGGGGFKSPRGGGRGGG 77 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P PP AP P PP P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P PP PP P P Sbjct: 522 PAPQPPSPPAPPPKP 536 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P PP A P P P Sbjct: 532 PPPKPAPPPRSPP-AAAPCNPAMAP 555 >SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P PA PPP +P PP P Sbjct: 342 PPIPRTRPAMTPPPISPTTGPPKSPAP 368 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PPP P P PPP PP Sbjct: 348 PTTPKTHPQLGPPP--PPPPPPPTPPP 372 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 P PP P P P P PPP P Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/52 (26%), Positives = 14/52 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPP 400 P P PP P PPPP P P PPP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P PPP + P PPP PP Sbjct: 1345 PRLPLP-PLRLPPPHSRLPLPPPKLPP 1370 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = -3 Query: 435 GXXGGG--XGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GGG G G GG G G G GG G GGG Sbjct: 132 GGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGME 191 Query: 261 GGXGXG 244 GG G G Sbjct: 192 GGMGGG 197 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = -3 Query: 414 GXGAXGGGXXAGXGXGGG---GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGXG 244 G G GGG G G GGG G G GGG GG G G Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGG 189 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP-----PXXXXXGXXXGXPGLPPNRGI 499 PPPP PPP A PPP P G G P PP G+ Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLP--PPGSGL 618 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 3/71 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP---XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPX 529 PPPP PPP PPP G G PP G + PP Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPG 562 Query: 530 P*IXGGGKTXP 562 GGG P Sbjct: 563 A-GQGGGPPPP 572 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P PPP P PP PP Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPP 104 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +2 Query: 359 PPPPXPXPAXXP--PPXAPXPXP-----PPXXPPXXXXXGXXXGXPGLPPNRG 496 PPPP P P PP P P PP PP P +PP G Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPPGIG 830 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/80 (30%), Positives = 25/80 (31%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 PPPP P P P P P PPP P LPP P PP Sbjct: 685 PPPPLPTPIASSEP-LPLPPPPPPTGIDIPHSPSKDDLP-LPP----PPEEVSLPPPDES 738 Query: 539 XGGGKTXPLLXXIFXKGPPR 598 K P + PPR Sbjct: 739 PPSSKHPPTVSPSSSSAPPR 758 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG G G GGG G G GG Sbjct: 3698 GGGYGGGGG-GYGGGGGGYGDGTGG 3721 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PPP PP Sbjct: 784 PPPEYPP---PPPGLARPNPPPPNPP 806 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG G G GA GGG G G GG Sbjct: 128 GGQAGSQAGGGAAGGGGQEGGGQGG 152 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G GGGG Sbjct: 118 GGQAGGGGQAGGQAGSQAGGGAAGGGG 144 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG GGG G G GGG Sbjct: 123 GGGQAGGQAGSQAGGGAAGGGGQEGGG 149 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P PP A PPP PP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G G +G GGGG Sbjct: 237 GASGGGGGYSGGGSGTHSGQAGGGGG 262 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 3/66 (4%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPXPXP 421 P PP P P P PP PP P PA P P P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Query: 422 PPXXPP 439 PP P Sbjct: 178 PPQAYP 183 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G GGG G G GG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG GA GGG G GG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGG 492 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 11/67 (16%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPX--PPPXXPPXXXXXGXXXGXP---GLPP------NRGIPXXL 511 P P PPP P P PPP P G P PP + G+P + Sbjct: 337 PAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPV 396 Query: 512 XRXPPXP 532 PP P Sbjct: 397 AAPPPAP 403 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGG Sbjct: 186 GGGGGGTTGGGGSGGEGTTGGG 207 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G GGG G G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG G GGG G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXG 367 G GGG G G GGG G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 64 GPVCGRGGGGRRGGGGCCGGGGGGGG 89 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PP P P P+ PP AP P PP Sbjct: 1166 PPQPPPVPSVQAPP-APPPAPP 1186 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXP---XPPPXXPP 439 PPP P PPP P P P P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPXPX---PAXXPPPXAPXPXPPPXXPP 439 PPPP P PPP P PP PP Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/67 (26%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA--PXPX 418 P P P PPP + PPPP P PA P Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQY 197 Query: 419 PPPXXPP 439 PPP P Sbjct: 198 PPPDVAP 204 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P PP P P PP P P PP Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 24.2 bits (50), Expect(2) = 5.9 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 11/34 (32%) Frame = +2 Query: 359 PPPPXPXP-----------AXXPPPXAPXPXPPP 427 PPPP P P PPP P PPP Sbjct: 1125 PPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPP 1158 Score = 23.0 bits (47), Expect(2) = 5.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 251 PXPPXPPPP 277 P PP PPPP Sbjct: 1122 PLPPPPPPP 1130 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXG 457 PP P PPP AP PP PP G Sbjct: 265 PPQYGPGRRDMPPPGAPPGMLPPGMPPHGMPPG 297 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 P PP P PPP P P P P Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PP P P PP P P PPP Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPP 232 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 28.7 bits (61), Expect = 7.4 Identities = 28/101 (27%), Positives = 28/101 (27%), Gaps = 4/101 (3%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP----PXAPXPXPPP 427 P PPPP A P P A P P P PPP Sbjct: 386 PLPPPPPQQASRIDYRASYGAAPPAPSLQAVCIDLPEPPLKAGDSPLKRSVKKPLPPPPP 445 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGG 550 G P LPP RG PP P GGG Sbjct: 446 QQAARINYRASY-GAPPLPPKRG------GGPPLPPKRGGG 479 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G+ GG G GGG Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGG 294 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.7 bits (61), Expect = 7.4 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 2/96 (2%) Frame = +2 Query: 251 PXPPX-PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPP 427 P PP PP P P PP P P PP P P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPL 318 Query: 428 XXPPXXXXXGXXXG-XPGLPPNRGIPXXLXRXPPXP 532 PP P PP P R PP P Sbjct: 319 RYPPSPIRYPPLPSRYPPSPPR--YPSSHPRYPPSP 352 >SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPP-XAPXPXP 421 P P PPP P P PP P PPP P P Sbjct: 874 PVRLPVATPPPVRVPVATPLPLYVFLLLPLPLFVFLLLPLPPVRVPVATPPPVRVPVATP 933 Query: 422 PP 427 PP Sbjct: 934 PP 935 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G + GG G G GGG Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGG 35 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G+ GGG GGGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGG 124 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G+ GGG GGGG Sbjct: 108 GSNGGGGDDDGSNGGGGDDDGSNGGGG 134 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 142 PPPPPPPPSPPP 153 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 466 PPMSPPPPTPPP 477 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGG Sbjct: 368 GGGRGGGRGGGR--GGFRGGRGGRGGG 392 >SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXP----GLPPNRGIP 502 PP P PA P A P PPP P G P G PP+ P Sbjct: 836 PPYPLYTPADAAFPPAQAPYPPPYPTPAGGYPPDQGGYPLQTMGPPPDAPPP 887 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP--XPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P P PPP PP P PP RG PP P Sbjct: 28 PPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDI---PPPPPPRRGFYDDYPPPPPPP 84 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNG 346 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 794 PPPPPPPPPPPP 805 >SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) Length = 293 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PP P P P P P P P PPP Sbjct: 243 PPTPSPTP---PSPTHPSPLPPP 262 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 28.3 bits (60), Expect = 9.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 163 PPQPPPPPLPPP 174 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P PP P P P P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPP 881 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 28.3 bits (60), Expect = 9.7 Identities = 20/68 (29%), Positives = 22/68 (32%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IX 541 PPP P P PP P P P G PG P +RG P Sbjct: 92 PPPTPPPQRRGPPGDPGPKGNKGQP-------GAQGRPGAPGDRGERGSAGSDGPKGEAG 144 Query: 542 GGGKTXPL 565 G G P+ Sbjct: 145 GPGPLGPI 152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.159 0.615 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,264,314 Number of Sequences: 59808 Number of extensions: 280889 Number of successful extensions: 6632 Number of sequences better than 10.0: 159 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2946 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -