BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N10 (929 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32350.1 68417.m04605 expressed protein contains Pfam profile... 32 0.47 At1g73410.1 68414.m08499 myb family transcription factor (MYB54)... 29 5.8 >At4g32350.1 68417.m04605 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 732 Score = 32.3 bits (70), Expect = 0.47 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 126 ERSSFYASWLRREVSD-HQPIFKVSPTPSRYSRLCHLGQGNGGREGLRD 269 ER FY + + HQPIF T +LGQGNG R G+ D Sbjct: 279 ERKEFYLHSKQNPAREKHQPIFNEGDTIVMKVNYGNLGQGNGHRPGVVD 327 >At1g73410.1 68414.m08499 myb family transcription factor (MYB54) identical to putative transcription factor (MYB54) GI:3941471 from [Arabidopsis thaliana] Length = 243 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 268 TLGESDQXLFGXGGYNREFFNDDRGKL 348 +L S+Q + GGYN + +DDR K+ Sbjct: 124 SLMASEQIMMSSGGYNHNYSSDDRKKI 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,429,870 Number of Sequences: 28952 Number of extensions: 282327 Number of successful extensions: 658 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2217402144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -