BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N09 (875 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.8 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 7.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 7.3 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 210 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 115 K PG S GD + + V H T++ W Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 512 WCGHHALPSTEHX*VPVATRLTLH 441 W GHH S VP T+ +H Sbjct: 135 WHGHHQKNSPYMDGVPFVTQCPIH 158 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 204 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 115 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 204 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 115 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,433 Number of Sequences: 336 Number of extensions: 3946 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -