BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N08 (862 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5I0E6 Cluster: Propanediol utilization protein; n=4; C... 35 3.0 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 33 7.0 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 33 7.0 UniRef50_Q65UU3 Cluster: Putative uncharacterized protein; n=2; ... 33 9.3 UniRef50_O25547 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 UniRef50_Q7P5T9 Cluster: Putative uncharacterized protein FNV086... 33 9.3 UniRef50_Q180D4 Cluster: Putative uncharacterized protein; n=2; ... 33 9.3 >UniRef50_A5I0E6 Cluster: Propanediol utilization protein; n=4; Clostridium botulinum|Rep: Propanediol utilization protein - Clostridium botulinum A str. ATCC 3502 Length = 279 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +2 Query: 173 KEDNSINTLAESAKKTIEELREKVESALAPETVKKNFGTMV-DSFN--EFYKN 322 KE NSI L K++IE+ K S ++ E++K+NF + D FN E YKN Sbjct: 174 KEMNSIEDLIPDLKESIEKRNIKNISRISEESIKRNFHRLTYDYFNTVEKYKN 226 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 513 PPPPPGGMGGVPPPPPPPPP 532 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 1058 PPPPPGGLGGPPPPPPPPPP 1077 >UniRef50_Q65UU3 Cluster: Putative uncharacterized protein; n=2; Pasteurellaceae|Rep: Putative uncharacterized protein - Mannheimia succiniciproducens (strain MBEL55E) Length = 449 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -1 Query: 406 LLHSIYLGLCT*ILKNYF--SGFRCFRGLQIFIKFVEAVYHRAKVFLNSL 263 LL I+LGLC + N F S F F G+ +F+ F+E + + + F+NSL Sbjct: 10 LLIIIFLGLCIVTIDNIFIVSDFVLF-GIFLFLLFLEVIINPKRNFINSL 58 >UniRef50_O25547 Cluster: Putative uncharacterized protein; n=1; Helicobacter pylori|Rep: Putative uncharacterized protein - Helicobacter pylori (Campylobacter pylori) Length = 140 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = +2 Query: 146 HAFVKRDAPKEDNSINTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNL 325 H + +D K + L E + EEL ES + + + + +F ++YK++ Sbjct: 69 HTYTSKDLEKIQKDLEELEEGVPELFEELERDEESIAKNKKTIQEYQNKIANFQKYYKDI 128 Query: 326 K 328 K Sbjct: 129 K 129 >UniRef50_Q7P5T9 Cluster: Putative uncharacterized protein FNV0869; n=1; Fusobacterium nucleatum subsp. vincentii ATCC 49256|Rep: Putative uncharacterized protein FNV0869 - Fusobacterium nucleatum subsp. vincentii ATCC 49256 Length = 129 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/71 (25%), Positives = 34/71 (47%) Frame = +2 Query: 152 FVKRDAPKEDNSINTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNEFYKNLKP 331 F+ + P NS + + KKT ++ + S + + +K + + + N+F+K LK Sbjct: 3 FIAGNTPSSKNSKRIITITNKKTGKKTTRLINSEVTEKYIKNSKADWLINKNKFFKMLKD 62 Query: 332 AEAPKA*EVIF 364 E P E+ F Sbjct: 63 KEKPYKVELYF 73 >UniRef50_Q180D4 Cluster: Putative uncharacterized protein; n=2; Clostridium difficile|Rep: Putative uncharacterized protein - Clostridium difficile (strain 630) Length = 349 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +2 Query: 140 NVHAFVKRDAPKED---NSINTLAESAKKTIEELREKVESALAPETVKKNFGTMVDSFNE 310 ++ ++KR+ K D NS N LAE K ++ L+E VE K+N ++ +NE Sbjct: 241 SIAEYLKRERDKNDTKVNSENELAEEECKVLDTLKENVE--------KENIDACIEFWNE 292 Query: 311 FYKN 322 + KN Sbjct: 293 YKKN 296 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,016,650 Number of Sequences: 1657284 Number of extensions: 10483810 Number of successful extensions: 32010 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31290 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 76243001646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -