BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N07 (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) 32 0.51 SB_42984| Best HMM Match : DUF1651 (HMM E-Value=7.2) 29 3.6 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 61.3 bits (142), Expect = 1e-09 Identities = 37/90 (41%), Positives = 50/90 (55%) Frame = -2 Query: 606 NLLVLQPKNKTVQN*LTN*FCKYPGNXIRMNIQVVKNDTKIHRNATEIRRIRFSFGVVGL 427 ++L+ KN+T + T C Y G+ I M + VKNDT H + R R S + Sbjct: 3 DILLKNDKNRTPERQGT---CTY-GSFILMKTRQVKNDTSTHTKPIKSSRNRLSLDMPTE 58 Query: 426 CVRSSIMKPSPPSEKRKLDARPSMMY*PLT 337 S +M P+PP E +KL+ARPSMMY PLT Sbjct: 59 LDLSRMMNPTPPIENKKLEARPSMMYCPLT 88 >SB_27523| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-09) Length = 666 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 412 TRPHTQPDHTKTESNSPYLCGVPMYFSVILYHLDIHAYXVARIFTEL 552 T P T+ D ++ ++P CG+ + +L+ + IH Y + +FT L Sbjct: 370 TDPGTRNDTEESPKSTPRKCGLALLSVTLLFTVFIHFYALQTLFTRL 416 >SB_42984| Best HMM Match : DUF1651 (HMM E-Value=7.2) Length = 173 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 310 QTCSLHAESC*WSVHHGRSCVELSLLTRRAWL 405 Q+ H C W + +G S EL+ ++RR W+ Sbjct: 142 QSAKTHGCQCKWRLANGSSMTELNNVSRRIWI 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,063,649 Number of Sequences: 59808 Number of extensions: 420717 Number of successful extensions: 803 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -