BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N04 (915 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 47 2e-05 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 8e-04 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 41 0.001 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 40 0.003 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 40 0.003 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 38 0.007 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 38 0.009 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 38 0.009 At1g26150.1 68414.m03192 protein kinase family protein similar t... 38 0.012 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 37 0.021 At1g61080.1 68414.m06877 proline-rich family protein 36 0.028 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.049 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 36 0.049 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 36 0.049 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 36 0.049 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 36 0.049 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 35 0.086 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 35 0.086 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.086 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.086 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.11 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 34 0.11 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 34 0.11 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.15 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 34 0.15 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 34 0.15 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 34 0.15 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.20 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 33 0.26 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.26 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 33 0.26 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 33 0.35 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 33 0.35 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 33 0.35 At5g38560.1 68418.m04662 protein kinase family protein contains ... 32 0.46 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 32 0.46 At1g10620.1 68414.m01204 protein kinase family protein contains ... 32 0.46 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.61 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 32 0.61 At3g50180.1 68416.m05486 hypothetical protein 32 0.61 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 32 0.61 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 32 0.61 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 32 0.61 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.81 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.81 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 0.81 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 31 0.81 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 31 1.1 At1g27710.1 68414.m03387 glycine-rich protein 31 1.1 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 31 1.4 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 31 1.4 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 1.4 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 1.4 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 31 1.4 At4g01985.1 68417.m00265 expressed protein 31 1.4 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 31 1.4 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 1.4 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 1.4 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 30 1.9 At4g18570.1 68417.m02749 proline-rich family protein common fami... 30 1.9 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 30 2.5 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.5 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 3.2 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 3.2 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 3.2 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 3.2 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 29 3.2 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 29 3.2 At5g51600.1 68418.m06397 microtubule associated protein (MAP65/A... 29 4.3 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 29 4.3 At5g46730.1 68418.m05757 glycine-rich protein 29 4.3 At5g44700.1 68418.m05477 leucine-rich repeat transmembrane prote... 29 4.3 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 4.3 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 29 4.3 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 29 4.3 At4g33660.1 68417.m04781 expressed protein 29 4.3 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 4.3 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 29 4.3 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 4.3 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 5.7 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 29 5.7 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 29 5.7 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 29 5.7 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 29 5.7 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 5.7 At3g51290.1 68416.m05614 proline-rich family protein 29 5.7 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 5.7 At3g24250.1 68416.m03044 glycine-rich protein 29 5.7 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 5.7 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 5.7 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 5.7 At1g29380.1 68414.m03592 hypothetical protein 29 5.7 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 5.7 At1g04800.1 68414.m00476 glycine-rich protein 29 5.7 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 7.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 28 7.5 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 28 7.5 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 7.5 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 28 7.5 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 28 7.5 At4g16240.1 68417.m02464 hypothetical protein 28 7.5 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 28 7.5 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 28 7.5 At1g75550.1 68414.m08780 glycine-rich protein 28 7.5 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 9.9 At4g21620.1 68417.m03134 glycine-rich protein 28 9.9 At4g08230.1 68417.m01358 glycine-rich protein 28 9.9 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 28 9.9 At1g70990.1 68414.m08190 proline-rich family protein 28 9.9 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 9.9 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 9.9 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 28 9.9 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.9 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/99 (27%), Positives = 32/99 (32%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P P P++S PP P P PP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP---PPPPPPPPPPPPVYSPPPPSPPPP 490 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 + P P PPP +PP P + PPP P P Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 42.3 bits (95), Expect = 4e-04 Identities = 32/130 (24%), Positives = 34/130 (26%) Frame = +2 Query: 521 SXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSX 700 S P PPP P PP P P P + PP P PPP Sbjct: 450 SPPPPPPPPPPPPVYSPPPPPPPPPPP----PPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Query: 701 VXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPX 880 P P P P + P PP P P PP P Sbjct: 506 PPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Query: 881 XXXXXPPXXP 910 PP P Sbjct: 566 PHSSPPPHSP 575 Score = 40.7 bits (91), Expect = 0.001 Identities = 36/135 (26%), Positives = 38/135 (28%), Gaps = 2/135 (1%) Frame = +2 Query: 512 VLNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 V +S P P P P PP P P P F P P PPP Sbjct: 517 VYSSPPPPPSPAPTPVYCTRPPPPPPHSPP----PPQFSPPPPEPYYYSSPPPPHSSPPP 572 Query: 692 XSXVXXXXXGPFXXXLXRXXPGPXP--RAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXX 865 S P P P P P P P PP P P PP + Sbjct: 573 HSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPP--PPPCIEYSPP 630 Query: 866 PGFPXXXXXXPPXXP 910 P P PP P Sbjct: 631 PPPPVVHYSSPPPPP 645 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/127 (24%), Positives = 39/127 (30%), Gaps = 4/127 (3%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P++S PP P P PP Sbjct: 426 PPPPSPPPPVYSPPP----PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP---PPPP 478 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXP----PPXPXPXXXPPXXGGSXXTXFSSXSX 888 + P + P PPP +PP P P PP P PP + + + Sbjct: 479 VYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPP 538 Query: 889 XXPPPXP 909 PP P Sbjct: 539 PPPPHSP 545 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/129 (24%), Positives = 36/129 (27%), Gaps = 8/129 (6%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P++S PP P P PP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYS----PPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP--------PXXGGSXXTXFS 876 + P PPP +P P PPP P P P S S Sbjct: 509 VYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHS 568 Query: 877 SXSXXXPPP 903 S PPP Sbjct: 569 SPPPHSPPP 577 Score = 38.7 bits (86), Expect = 0.005 Identities = 31/123 (25%), Positives = 35/123 (28%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PP P P P P + PP P P PP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSP--PPPSPPPPVYSPPPPPPPPP------P 447 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 + P P PPP +PP P PPP P PP +S PP Sbjct: 448 VYSPPPPPPPPPPPPVYSPPPPPPPP---PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Query: 901 PXP 909 P P Sbjct: 505 PPP 507 Score = 33.1 bits (72), Expect = 0.26 Identities = 33/131 (25%), Positives = 33/131 (25%), Gaps = 1/131 (0%) Frame = +2 Query: 521 SXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSW-XPPXXXXPXAXXXXPPPXS 697 S P PPP P PP P P P S PP P PP Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Query: 698 XVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 F P P P P PP P P PP P P Sbjct: 541 PPHSPPPPQF------SPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Query: 878 XXXXXXPPXXP 910 PP P Sbjct: 595 PTPVSSPPPTP 605 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +1 Query: 751 PXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXT-XFSSXSXXXPPPXPXA 915 P PPP +PP P PPP P PP + S PPP P A Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSA 698 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 41.5 bits (93), Expect = 8e-04 Identities = 32/126 (25%), Positives = 35/126 (27%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P FS P P PP Sbjct: 526 PPPPPPPPLFTSTTSFSPSQP-PPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPS 584 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 + P A P P P PP P+ P P P PP GS + Sbjct: 585 RSIP---PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPP 641 Query: 892 XPPPXP 909 PPP P Sbjct: 642 PPPPPP 647 Score = 41.5 bits (93), Expect = 8e-04 Identities = 34/125 (27%), Positives = 34/125 (27%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P R PP PS P Sbjct: 572 PPPPPPPPPPL---PSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSF 628 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 G P PPP PP PPP P P P GS S PP Sbjct: 629 GSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP---PTSHSGSIRVGPPSTPPPPPP 685 Query: 901 PXPXA 915 P P A Sbjct: 686 PPPKA 690 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP + T P P P PP + T FS PPP P Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMST--TSFSPSQPPPPPPPP 532 Score = 30.3 bits (65), Expect = 1.9 Identities = 27/94 (28%), Positives = 29/94 (30%), Gaps = 13/94 (13%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPX---GTPPXXP----AKTXXXPPPXPXPX 831 PS PP P A P PP G PP P +KT PPP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKT 736 Query: 832 XXPPXXGG------SXXTXFSSXSXXXPPPXPXA 915 PP G S + PPP P A Sbjct: 737 PVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPA 770 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 751 PXPPPXGTPPXXP-AKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP PP T P P P PP S T FS PPP P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTS-TTSFSPSQPPPPPPLP 553 Score = 29.5 bits (63), Expect = 3.2 Identities = 31/132 (23%), Positives = 34/132 (25%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 +N P PPP P PP P P R P PP PPP Sbjct: 568 INKTPPPPPPPPPPLPSRSIPP-PLAQPPPPRPPP-----PPPPPPSSRSIPSPSAPPPP 621 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGF 874 + P P P P K PP P P + G Sbjct: 622 PPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP-----PTSHSGSIRVGP 676 Query: 875 PXXXXXXPPXXP 910 P PP P Sbjct: 677 PSTPPPPPPPPP 688 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/126 (24%), Positives = 33/126 (26%), Gaps = 3/126 (2%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PP P P P P PP P P P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXP---PPXPXPXXXPPXXGGSXXTXFSSXSXX 891 + P P PP PP P + P PP P P PP S S Sbjct: 579 VYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVY 638 Query: 892 XPPPXP 909 PPP P Sbjct: 639 SPPPRP 644 Score = 37.5 bits (83), Expect = 0.012 Identities = 29/111 (26%), Positives = 33/111 (29%), Gaps = 1/111 (0%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 +NS P PP P PP P P P + PP P PPP Sbjct: 523 VNSPPPPVYSPPPPPPPVHSPPPPVHSPP---PPPVYSPPPPPPPVHSPPPPVFSPPPPV 579 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPP-XXXPXPLXXPP 844 P P P +P P P PP P P+ PP Sbjct: 580 YSPPPPVHSPPPPVHSPPPPAPV-HSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 34.3 bits (75), Expect = 0.11 Identities = 31/130 (23%), Positives = 32/130 (24%), Gaps = 3/130 (2%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXP--PXXXPXXXXPSXXPPXXXR 702 TP P P P P+ SR P P P P P R Sbjct: 456 TPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKR 515 Query: 703 XXXQXXXFXGXPX-AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSS 879 P P PPP P PPP P PP FS Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP 575 Query: 880 XSXXXPPPXP 909 PP P Sbjct: 576 PPPVYSPPPP 585 Score = 32.3 bits (70), Expect = 0.46 Identities = 26/104 (25%), Positives = 28/104 (26%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P + P+ S PP P P PP Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPP--PVHSP---PPPVHSPPPPAPVHSPPPPVHSPP 613 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP PP PPP P PP Sbjct: 614 PP------PPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP 651 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/124 (25%), Positives = 37/124 (29%) Frame = +2 Query: 500 IKYFVLNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXX 679 + VL S P PPP P PP +PG G P P + Sbjct: 151 LSVIVLWSSDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSP 210 Query: 680 XPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXA 859 P P S + GP PGP P + P P P P P P Sbjct: 211 TPGPDSPL--PSPGP---DSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPL 265 Query: 860 XXPG 871 PG Sbjct: 266 PSPG 269 Score = 31.9 bits (69), Expect = 0.61 Identities = 32/130 (24%), Positives = 35/130 (26%), Gaps = 4/130 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P PL S G P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPG---PDSPLPLPGPPPSPSPTPGPDSP 217 Query: 712 QXXXFXGXPXAXXPXPPPXGTP---PXXPAKTXXXPP-PXPXPXXXPPXXGGSXXTXFSS 879 P P PPP +P P P + PP P P P P + S Sbjct: 218 LPSPGPDSPLPL-PGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPS 276 Query: 880 XSXXXPPPXP 909 P P P Sbjct: 277 PGPDPPLPSP 286 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/127 (23%), Positives = 32/127 (25%), Gaps = 1/127 (0%) Frame = +1 Query: 532 PXXPP-PXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 P PP P P P P P + P P PP Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVK 104 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSX 888 + P PPP TP P T PPP PP T Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPC 164 Query: 889 XXPPPXP 909 PPP P Sbjct: 165 PPPPPTP 171 Score = 37.5 bits (83), Expect = 0.012 Identities = 29/106 (27%), Positives = 31/106 (29%), Gaps = 2/106 (1%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXP-SXXPPXXXRXX 708 P PPP P P P P + PP P PP Sbjct: 74 PCPPPPYTPKPPTVKPPPP---PYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXX-PAKTXXXPPPXPXPXXXPP 843 + P P PPP TPP P PPP P P PP Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.3 bits (70), Expect = 0.46 Identities = 32/126 (25%), Positives = 32/126 (25%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PP P PP P P P V PP P PP Sbjct: 64 PTVKPPPPYIPC--PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXX 892 P P P P P P KP PP P P P P P Sbjct: 122 PPPPTPYT----PPPPTPYTP-PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Query: 893 XPPXXP 910 P P Sbjct: 177 KPETCP 182 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGT-PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP T PP P ++ P P P P PP T PPP P Sbjct: 56 PEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P P PP T PPP P P PP Sbjct: 80 PPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P PPP P P PP S S PP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP P P PPP PP P PP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Query: 823 XPXXXPP 843 PP Sbjct: 442 YVYPPPP 448 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXG-TPPXXPAKTXXXPPPX 819 PP P P PP P P PPP PP P PPP Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPS 450 Query: 820 PXPXXXP 840 P P P Sbjct: 451 PQPYMYP 457 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP P P PPP P P+ PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Query: 823 XP 828 P Sbjct: 450 SP 451 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 521 SXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 S P PPP P PP P P P+ PP P PPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P P P P P PP P P PP P P PP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P P P P PP P P PP P P PP P Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/53 (26%), Positives = 17/53 (32%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPP 690 P PPP P P +P P ++ PP P P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 37.9 bits (84), Expect = 0.009 Identities = 37/149 (24%), Positives = 46/149 (30%), Gaps = 15/149 (10%) Frame = +2 Query: 509 FVLNSXXXPXXPPPXPXXXXXXPP-----XPXXXSPGXRGXPFFXGVSWXPP---XXXXP 664 +V +S P PP P PP P SP ++ V+ PP P Sbjct: 517 YVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYP 576 Query: 665 XAXXXXPPP----XSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPL 832 PPP V P + P P P +PL P PP P P+ Sbjct: 577 PVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPP---PSPV 633 Query: 833 XXPPXXGXAXXPG---FPXXXXXXPPXXP 910 PP P +P PP P Sbjct: 634 YYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP P+ PPP P P PP S + S PPP P Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSS---PPPPP 488 Score = 30.3 bits (65), Expect = 1.9 Identities = 33/128 (25%), Positives = 39/128 (30%), Gaps = 5/128 (3%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPP--XXXXPXAXXXXPPPXSXVXXXX 715 PPP P PP P S P + S PP P PPP Sbjct: 484 PPPPPYVYSSPPPPPYVYS---SPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPP 540 Query: 716 XGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPG---FPXXX 886 + + + P P P P Q P PP P P+ PP P +P Sbjct: 541 PVVYYAPVTQSPPPPSP-VYYPPVTQSP--PP---PSPVYYPPVTNSPPPPSPVYYPPVT 594 Query: 887 XXXPPXXP 910 PP P Sbjct: 595 YSPPPPSP 602 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPX--PXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP + P P PPP P PP S + S PPP P Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSP 529 Score = 28.7 bits (61), Expect = 5.7 Identities = 33/138 (23%), Positives = 39/138 (28%), Gaps = 15/138 (10%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXP-----FFXGVSWXPP---XXXXPXAXXXXPPP-- 691 PPP PP P P P ++ V+ PP P PPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Query: 692 --XSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXX 865 V P P P +P+ P PP P PL PP Sbjct: 573 VYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPP---PSPLYYPPVTPSPPP 629 Query: 866 PG---FPXXXXXXPPXXP 910 P +P PP P Sbjct: 630 PSPVYYPPVTPSPPPPSP 647 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/60 (25%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 736 PXAXXPXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP +PP + PPP P P ++ + PPP P Sbjct: 498 PYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 37.5 bits (83), Expect = 0.012 Identities = 23/89 (25%), Positives = 23/89 (25%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP P PPP T PA PPP Sbjct: 63 PPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPES 122 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP S PPP P Sbjct: 123 SPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 36.3 bits (80), Expect = 0.028 Identities = 25/100 (25%), Positives = 29/100 (29%) Frame = +1 Query: 544 PPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXX 723 PP P P G P + PP P P+ PP Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP-- 119 Query: 724 FXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PPP PP P + P P P PP Sbjct: 120 ----PESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPP 155 Score = 29.1 bits (62), Expect = 4.3 Identities = 27/103 (26%), Positives = 29/103 (28%), Gaps = 2/103 (1%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP SP P S PP P PP V Sbjct: 124 PPPPPPTEA--PPTTPITSPSPPTNPPPPPES--PPSLPAPDPPSNPLPPPKLVPPSHSP 179 Query: 722 P--FXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPP 844 P P P P P ++P PP P PP Sbjct: 180 PRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/85 (28%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGX-PXAXXPXP-----PPXGTPPXXPAKTXXXPPPXPXPXX 834 PS PP + Q P P P P +PP P +T P P P P Sbjct: 217 PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPL- 275 Query: 835 XPPXXGGSXXTXFSSXSXXXPPPXP 909 P S T S PP P Sbjct: 276 --PSNSSSPPTLLPPSSVVSPPSPP 298 Score = 27.9 bits (59), Expect = 9.9 Identities = 25/108 (23%), Positives = 26/108 (24%), Gaps = 3/108 (2%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXP---PXXX 699 TP PP P P P P+ PP P P P P Sbjct: 66 TPLSSPPPEPSPPS----PSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE 121 Query: 700 RXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P PP P P P P PP Sbjct: 122 SSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 5/65 (7%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXX-----PPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P P PPP TPP PPP P P PP T + PP Sbjct: 122 PPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRPP 181 Query: 901 PXPXA 915 P P A Sbjct: 182 PPPPA 186 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/87 (25%), Positives = 24/87 (27%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P+ PP P P PPP P T P Sbjct: 121 PPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTTGHHHHRP 180 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP + T S PPP Sbjct: 181 PP---PPPATTTPITNTSDHHQLHPPP 204 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 36.3 bits (80), Expect = 0.028 Identities = 32/129 (24%), Positives = 34/129 (26%), Gaps = 3/129 (2%) Frame = +2 Query: 533 PXXPPPXPXXXXXX---PPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXV 703 P PPP P PP P P F PP PPP + Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPL 516 Query: 704 XXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXX 883 P P P PRA + P P P P PP A P P Sbjct: 517 PTTIAAP-------PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Query: 884 XXXXPPXXP 910 P P Sbjct: 570 MQNRAPSPP 578 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS----XXTXFSSXSXXXPPPXP 909 P PPP P P K PPP P P P + F PPP P Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPP 512 Score = 31.9 bits (69), Expect = 0.61 Identities = 26/106 (24%), Positives = 29/106 (27%), Gaps = 5/106 (4%) Frame = +2 Query: 521 SXXXPXXPPPXP--XXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 S P PPP P PP P + P G + PP P PPP Sbjct: 506 SAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Query: 695 SXVXXXXXGPFXXXLXRXXP---GPXPRAPLXPXXQKPXXPPXXXP 823 P + GP P P P PP P Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/94 (25%), Positives = 26/94 (27%), Gaps = 3/94 (3%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP R G + P PP PP P PPP P Sbjct: 554 PPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP----PPPMPLANGATPPPPP 609 Query: 823 XPXXXPPXXGG---SXXTXFSSXSXXXPPPXPXA 915 P G + PPP P A Sbjct: 610 PPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGA 643 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PPP PP KT P P P P PP S PPP P A Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPP--TPPI----ADIAISMPPPPPPPPPPPA 465 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 A P P P TPP PPP P P PP + PPP P A Sbjct: 433 ASLPLPSPPPTPPIADIAISMPPPPPPPP---PP----PAVMPLKHFAPPPPPPLPPA 483 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/89 (25%), Positives = 25/89 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP R P PPP PP + PPP P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPP---PPPPGTQAAPPPPPPP 568 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P +S S PPP P Sbjct: 569 PMQNRAP--SPPPMPMGNSGSGGPPPPPP 595 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/75 (24%), Positives = 20/75 (26%) Frame = +3 Query: 684 PPPXPPXXXTXXXLXRXXSGGGPXAPXXGHPSXPXXKNPXXPPXXXXSXXXSPPXGGXXX 863 PPP PP L P P P P PP +PP Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP 515 Query: 864 XXVFLXLXXXPPPXP 908 + PPP P Sbjct: 516 LPTTIAAPPPPPPPP 530 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP TPP PA T PP P PP Sbjct: 99 PPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 35.1 bits (77), Expect = 0.065 Identities = 29/124 (23%), Positives = 31/124 (25%), Gaps = 1/124 (0%) Frame = +2 Query: 542 PPPXPXXXXXXP-PXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXX 718 PPP P P P P P P F P PP + Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPP 90 Query: 719 GPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXP 898 P L P P + P PP P P PP P P P Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALP-PKPLPP 149 Query: 899 PXXP 910 P P Sbjct: 150 PLSP 153 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = +1 Query: 634 FLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXX-PXPPPXGTPPXXPAKTXXXP 810 + PP P PP F P A P PPP T P A T Sbjct: 29 YCPPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPAL 88 Query: 811 PPXPXPXXXPP 843 PP P P P Sbjct: 89 PPKPLPPPLSP 99 Score = 34.3 bits (75), Expect = 0.11 Identities = 30/109 (27%), Positives = 31/109 (28%), Gaps = 5/109 (4%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXX-----PXXXXPSXXPPXXXRX 705 PPP P P P PL PP P P PP Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPA-- 128 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P A P P P PP P +T PPP P PP G Sbjct: 129 ITPPPPLATTPPALPPKPLP---PPLSPPQTTPPPPPAITPPLSPPLVG 174 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP TPP PA T PP P PP ++ P P P Sbjct: 96 PLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLP 148 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P P P +PP P +T PPP P P Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 29.5 bits (63), Expect = 3.2 Identities = 29/122 (23%), Positives = 29/122 (23%), Gaps = 1/122 (0%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P PP P P PP Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPP---PVATTPPALPPKPLPPPLSPP 100 Query: 721 XFXGXPXAXXPXPPPXG-TPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXP 897 P PPP TPP P PPP P P S P Sbjct: 101 QTTPPPPPAITPPPPPAITPPLSPPPPAITPPP-PLATTPPALPPKPLPPPLSPPQTTPP 159 Query: 898 PP 903 PP Sbjct: 160 PP 161 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 700 RXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 R Q G P P P T P +T PPP P PP G Sbjct: 245 RRIPQGFSCPGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPPLVG 295 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/53 (26%), Positives = 16/53 (30%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP P P P P PP S ++ P P P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP 94 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 35.5 bits (78), Expect = 0.049 Identities = 32/133 (24%), Positives = 38/133 (28%), Gaps = 1/133 (0%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 ++S P PP P PP P P P S PP P PPP Sbjct: 689 VHSPPPPVHSPPPPVHS---PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPP 745 Query: 695 SXVXXXXXGPFXXXLXRXX-PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPG 871 + + P P P P P P P P P+ PP + P Sbjct: 746 APIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Query: 872 FPXXXXXXPPXXP 910 P P P Sbjct: 806 SPIYSPPPPVFSP 818 Score = 34.3 bits (75), Expect = 0.11 Identities = 26/92 (28%), Positives = 29/92 (31%), Gaps = 3/92 (3%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP-- 816 PP P S PP + P PPP +PP P + PPP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHS--PPPPVH 779 Query: 817 -XPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP S S PPP P Sbjct: 780 SPPPPVHSPPPPVHSPPPPVHS----PPPPSP 807 Score = 33.1 bits (72), Expect = 0.26 Identities = 31/126 (24%), Positives = 33/126 (26%), Gaps = 3/126 (2%) Frame = +2 Query: 533 PXXPP---PXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXV 703 P PP P P PP P P P S PP P PPP V Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP--PV 696 Query: 704 XXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXX 883 P P +P P P P P+ PP P P Sbjct: 697 HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPV 756 Query: 884 XXXXPP 901 PP Sbjct: 757 HSPPPP 762 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/87 (25%), Positives = 23/87 (26%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP + F P A PPP P P PPP P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPP--PPVHSPPPPVHSPPPPP 770 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PP PPP Sbjct: 771 VHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/90 (24%), Positives = 24/90 (26%), Gaps = 3/90 (3%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXP---P 813 PP P P PP P PPP +PP P + P P Sbjct: 642 PPVHSPPPPPPVHSPPPPV--FSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSP 699 Query: 814 PXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PP PPP Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 27.9 bits (59), Expect = 9.9 Identities = 24/105 (22%), Positives = 28/105 (26%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 +P PPP P P P++S PP P PP Sbjct: 646 SPPPPPPVHSPPPPVFSPPPPMHSPPP--PVYS----PPPPVHSPPPPPVHSPPPPVHSP 699 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP PP + P P P PP Sbjct: 700 PPPVHSP-PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP 743 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/92 (23%), Positives = 23/92 (25%), Gaps = 3/92 (3%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXP---P 813 PP P PP P P PP PP P + P P Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP--PVHSPPPPVHSP 706 Query: 814 PXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP PPP P Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 35.5 bits (78), Expect = 0.049 Identities = 30/131 (22%), Positives = 35/131 (26%), Gaps = 5/131 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXX--PSXXPPXXXRX 705 P PPP P P P++S PP P P PP + Sbjct: 166 PIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKP 225 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXS 885 P P P +PP P P P P PP +S Sbjct: 226 PTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPV 285 Query: 886 XXXP---PPXP 909 P PP P Sbjct: 286 KPPPVHKPPTP 296 Score = 34.3 bits (75), Expect = 0.11 Identities = 24/101 (23%), Positives = 29/101 (28%), Gaps = 3/101 (2%) Frame = +1 Query: 616 PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAK 795 P++S PP P P PP + P P P +PP P Sbjct: 61 PIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 120 Query: 796 TXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXP---PPXP 909 P P P PP +S P PP P Sbjct: 121 IQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/107 (27%), Positives = 31/107 (28%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P++S PP P P PP Sbjct: 402 PIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPT--PIYSPPVKP---- 455 Query: 712 QXXXFXGXPXAXXPXP---PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P PP PP P PP P P PP Sbjct: 456 -------PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPP 495 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/107 (27%), Positives = 31/107 (28%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P +S PP P P+ PP Sbjct: 452 PVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPT--PTYSPPVKP---- 505 Query: 712 QXXXFXGXPXAXXPXP---PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P PP PP P PP P P PP Sbjct: 506 -------PPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP 545 Score = 33.9 bits (74), Expect = 0.15 Identities = 31/131 (23%), Positives = 35/131 (26%), Gaps = 5/131 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX-PSXXPPXXXRX 705 P PPP P P P P +S PP P P PP + Sbjct: 485 PVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKP 544 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXS 885 P P P +PP P P P P PP +S Sbjct: 545 PTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPI 604 Query: 886 XXXP---PPXP 909 P PP P Sbjct: 605 KPPPVHKPPTP 615 Score = 33.5 bits (73), Expect = 0.20 Identities = 32/133 (24%), Positives = 36/133 (27%), Gaps = 7/133 (5%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 P PPP P P P P +S PP P P+ PP Sbjct: 132 PIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPT--PTYSPPIKPPVH 189 Query: 709 XQXXXFXGXPXAXXPX---PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSS 879 P P P P +PP P P P P PP +S Sbjct: 190 KPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSP 249 Query: 880 XSXXXP---PPXP 909 P PP P Sbjct: 250 PIKPPPVHKPPTP 262 Score = 33.1 bits (72), Expect = 0.26 Identities = 31/132 (23%), Positives = 35/132 (26%), Gaps = 6/132 (4%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP + Sbjct: 552 PIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK 611 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSX 882 P P P +PP P P P P PP +S Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPP 671 Query: 883 SXXXP---PPXP 909 P PP P Sbjct: 672 VKPPPVQLPPTP 683 Score = 32.7 bits (71), Expect = 0.35 Identities = 26/107 (24%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP + Sbjct: 586 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHK 645 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P +PP P P P P PP Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 32.3 bits (70), Expect = 0.46 Identities = 26/107 (24%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP + Sbjct: 603 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQK 662 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P +PP P P P P PP Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 31.9 bits (69), Expect = 0.61 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 8/112 (7%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX---PSXXPPXXX 699 P PPP P P P P++S PP P P PP Sbjct: 250 PIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQK 309 Query: 700 RXXXQXXX-FXGXPXAXXPXP---PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P PP PP P PP P P PP Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPP 361 Score = 31.9 bits (69), Expect = 0.61 Identities = 32/132 (24%), Positives = 36/132 (27%), Gaps = 6/132 (4%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP + Sbjct: 267 PVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQK 326 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSX 882 P P P P +PP P P P P PP +S Sbjct: 327 PPTPTYSPPIKPPPVKP-PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPP 385 Query: 883 SXXXP---PPXP 909 P PP P Sbjct: 386 VKPPPIQKPPTP 397 Score = 31.5 bits (68), Expect = 0.81 Identities = 29/108 (26%), Positives = 32/108 (29%), Gaps = 4/108 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 P PPP P P P P++S PP P P+ PP Sbjct: 351 PVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPT--PTYSPPIKP--- 405 Query: 709 XQXXXFXGXPXAXXPXP---PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P PP PP P PP P P PP Sbjct: 406 --------PPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/107 (24%), Positives = 28/107 (26%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP Sbjct: 620 PIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQL 679 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P +PP P P P P PP Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 30.3 bits (65), Expect = 1.9 Identities = 30/133 (22%), Positives = 35/133 (26%), Gaps = 6/133 (4%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXX 699 +P PP P P P P +S PP P P PP Sbjct: 517 SPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVH 576 Query: 700 RXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSS 879 + P P P +PP P P P P PP +S Sbjct: 577 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 636 Query: 880 XSXXXP---PPXP 909 P PP P Sbjct: 637 PIKPPPVHKPPTP 649 Score = 29.5 bits (63), Expect = 3.2 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 4/112 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 P PPP P P P P +S PP P P+ PP Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPT--PTYSPPVKPPPV 694 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP---XPXPXXXPPXXGG 855 P PPP PP PPP P P P GG Sbjct: 695 QVPPTPTYSPPVK---PPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGG 743 Score = 28.7 bits (61), Expect = 5.7 Identities = 26/107 (24%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGX-PLFSRGFLXPPXXXPXXXX--PSXXPPXXXR 702 P PPP P P P P +S PP P P PP + Sbjct: 66 PIYPPPIQKPPTYSP--PIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQK 123 Query: 703 XXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P +PP P P P P PP Sbjct: 124 PPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.5 bits (78), Expect = 0.049 Identities = 32/126 (25%), Positives = 35/126 (27%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PP P PP P SP P S PP P PPP Sbjct: 514 PVYSPPPPPPVYSPPPPPPVYSP----PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXX 892 P P P +P P P P P P+ PP + P P Sbjct: 570 VHSPPPPV---HSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPP 626 Query: 893 XPPXXP 910 P P Sbjct: 627 PPVFSP 632 Score = 35.1 bits (77), Expect = 0.065 Identities = 27/101 (26%), Positives = 30/101 (29%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P + P+ S PP P P PP Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSP---PPPVFSPPP--PVHSPPPPVYSPPPPV 650 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP +PP P K PP P PP Sbjct: 651 YSPPPPPVKSPPPPPVYSPPLLPPK--MSSPPTQTPVNSPP 689 Score = 34.7 bits (76), Expect = 0.086 Identities = 31/123 (25%), Positives = 33/123 (26%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P P P S PP P PPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYS 586 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P P +P P P P P P+ PP P P P Sbjct: 587 P---------PPPPVHSP-PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPV 636 Query: 902 XXP 910 P Sbjct: 637 HSP 639 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/92 (25%), Positives = 24/92 (26%), Gaps = 3/92 (3%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXX---PXPPPXGTPPXXPAKTXXXPP 813 PP P P P R P P PPP +PP P PP Sbjct: 471 PPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPP 530 Query: 814 PXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP S PP P Sbjct: 531 PPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 33.1 bits (72), Expect = 0.26 Identities = 25/109 (22%), Positives = 28/109 (25%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 ++S P PP P PP P P PP P PPP Sbjct: 577 VHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPV 636 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXP 841 P + P P P P P PP P P Sbjct: 637 HSPPPPVYSP-PPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP +PP P PPP P PP S PP P Sbjct: 514 PVYSPPPPPPVYSPPPPPP--VYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 31.1 bits (67), Expect = 1.1 Identities = 30/132 (22%), Positives = 34/132 (25%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 ++S P PP P PP P P P V PP P PPP Sbjct: 556 VHSPPPPVHSPPPPVHS---PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGF 874 P P +P P P P P+ PP P Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLL 672 Query: 875 PXXXXXXPPXXP 910 P P P Sbjct: 673 PPKMSSPPTQTP 684 Score = 29.9 bits (64), Expect = 2.5 Identities = 30/129 (23%), Positives = 33/129 (25%), Gaps = 6/129 (4%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSP------GXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 P PP P PP P P P PP P PPP Sbjct: 497 PVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPV 556 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGF 874 P P P +P P P P P P+ PP + P Sbjct: 557 HSPPPPVHSPPPPV---HSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP-- 611 Query: 875 PXXXXXXPP 901 P PP Sbjct: 612 PVYSPPPPP 620 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 6/59 (10%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP------XXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P K PPP P P PP SS + PPP P Sbjct: 241 PTPPPP-PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP PP P PPP P P PP +S PPP P Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYS------PPPPP 762 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/60 (31%), Positives = 23/60 (38%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G P P P G+PP P T P P P GGS + ++ S PP P Sbjct: 466 GSPPTSPTTPTPGGSPPSSP--TTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSP 523 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G P + P P G+PP P T P P P GGS + S S P P Sbjct: 479 GSPPSSPTTPTPGGSPPSSP--TTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSP 536 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 9/67 (13%) Frame = +1 Query: 736 PXAXXPXPP----PXGTPPXX-----PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSX 888 P P PP P G+PP P T PP P P PP ++ S Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSP 465 Query: 889 XXPPPXP 909 PP P Sbjct: 466 GSPPTSP 472 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P + P PP TPP + PP P PP G S SS S PP P Sbjct: 554 PSSPIPSPPTPSTPPTPISPGQNSPPIIP----SPPFTGPSPP---SSPSPPLPPVIP 604 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 34.7 bits (76), Expect = 0.086 Identities = 31/123 (25%), Positives = 34/123 (27%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP PP P SP P + S PP P PPP Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPS-PIY---SPPPPVHSPPPPVYSSPPP---------- 569 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P P +P P P P P P+ PP P P P Sbjct: 570 PHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPV 629 Query: 902 XXP 910 P Sbjct: 630 YSP 632 Score = 34.3 bits (75), Expect = 0.11 Identities = 29/107 (27%), Positives = 31/107 (28%), Gaps = 6/107 (5%) Frame = +2 Query: 542 PPPXPXXXXXXPPXP-XXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXX 718 PPP P PP P P P S PP P PPP S Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 719 GPFXXXLXRXXP--GPXPRAPL---XPXXQKPXXPPXXXPXPLXXPP 844 P P P P +P+ P P P P P PP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPX-AXXPXPPPXGTPPXXPAKTXXXPPPX 819 PP P P PP P P PP PP P PPP Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Query: 820 PXPXXXPPXXGGSXXT-XFSSXSXXXPPPXP 909 P PP + +S PP P Sbjct: 598 PVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.086 Identities = 32/128 (25%), Positives = 35/128 (27%), Gaps = 2/128 (1%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P P P P P P S PP P P PP + Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Query: 712 QXXXFXGXPXAXXPXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXS 885 + A P P P +PP PA P P P P PP T S Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCPSPPKPPA-----PTPKPVPPHGPPPKPAPAPTPAPSPK 132 Query: 886 XXXPPPXP 909 PP P Sbjct: 133 PAPSPPKP 140 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/85 (27%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = +1 Query: 658 PXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXX-PPPXPXPXX 834 P PS P + G P P P PP P+ + PPP P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 835 XPPXXGGSXXTXFSSXSXXXPPPXP 909 PP T PPP P Sbjct: 63 VPPP--ACPPTPPKPQPKPAPPPEP 85 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PPP PP P K+ P P P P PP Sbjct: 57 PPSCTPSPPPPSPPP--PKKSSCPPSPLPPPPPPPP 90 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P PPP PP P+ T PPP P P Sbjct: 43 PCLQNQPPPPPSPPP--PSCTPSPPPPSPPP 71 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PPP P T PPP P P P + SS PPP P A Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP-----TPIVHTSSPPPPPPPPPPPA 738 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/75 (26%), Positives = 22/75 (29%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXX 864 PP Q P P PP TP + PPP P P P G Sbjct: 690 PPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISA 749 Query: 865 TXFSSXSXXXPPPXP 909 S + PP P Sbjct: 750 MKSSPPAPPAPPRLP 764 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 9/60 (15%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXP---------XXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP PA PPP P P PP + T S PPP P Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Score = 27.9 bits (59), Expect = 9.9 Identities = 30/126 (23%), Positives = 34/126 (26%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P+ PP P P PP Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPP----PPPAPPTPQSNGI 747 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 A PP PP P + PPP P PP G + + Sbjct: 748 S---------AMKSSPPAPPAPPRLPTHSASPPPPTAPP---PPPLG-------QTRAPS 788 Query: 892 XPPPXP 909 PPP P Sbjct: 789 APPPPP 794 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXX---GGSXXTXFSSXSXXXPPPXPXA 915 P PPP PP P P P P PP G F+ PPP P A Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSA 80 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP P + PPP P P PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPS---PPPSPPPPQLPP 96 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP P PP P P PP Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PPP P P+ PPP P P PP Sbjct: 59 ADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PPP PP P PP P P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP +P P PPP P P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPP 74 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP P PP P P PP Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPP--PPQLPPPPQLPP 102 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P P P P PP P P PP P P PP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP-XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P P PA PPP P P PP S PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXA-XXPGFPXXXXXXPPXXP 910 P P P A P P PP P P PP + P P PP P Sbjct: 54 PEPEP-ADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP +PP PPP P P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PP P P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/87 (26%), Positives = 25/87 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P+ PP P P P PP P PPP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPP----PVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP S +S PPP Sbjct: 82 PPPATPPPV-ASPPPPVASPPPATPPP 107 Score = 33.9 bits (74), Expect = 0.15 Identities = 32/127 (25%), Positives = 36/127 (28%), Gaps = 2/127 (1%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 TP PPP P P P P+ + PP P S P Sbjct: 35 TPTTPPPAATPPPVSAPPPVTTSPP----PVTTA----PPPANPPPPVSSPPPASPPPAT 86 Query: 709 XQXXXFXGXPXAXXPX--PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSX 882 P A P PPP TPP P + P P P P S + Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Query: 883 SXXXPPP 903 S P P Sbjct: 147 SSDAPGP 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/127 (22%), Positives = 30/127 (23%), Gaps = 1/127 (0%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P P P P P+ PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAP---PPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPPXXGGSXXTXFSSXSX 888 P P PP PP P PP P P P + S S Sbjct: 80 ASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Query: 889 XXPPPXP 909 PP P Sbjct: 140 SSSPPLP 146 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/87 (26%), Positives = 25/87 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P+ PP P P P PP P PPP Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPP----PVTTSPPPVTTAPPPANPPPPVSSPPPAS 81 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP S +S PPP Sbjct: 82 PPPATPPPV-ASPPPPVASPPPATPPP 107 Score = 33.9 bits (74), Expect = 0.15 Identities = 32/127 (25%), Positives = 36/127 (28%), Gaps = 2/127 (1%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 TP PPP P P P P+ + PP P S P Sbjct: 35 TPTTPPPAATPPPVSAPPPVTTSPP----PVTTA----PPPANPPPPVSSPPPASPPPAT 86 Query: 709 XQXXXFXGXPXAXXPX--PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSX 882 P A P PPP TPP P + P P P P S + Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Query: 883 SXXXPPP 903 S P P Sbjct: 147 SSDAPGP 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/127 (22%), Positives = 30/127 (23%), Gaps = 1/127 (0%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P P P P P+ PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAP---PPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPPXXGGSXXTXFSSXSX 888 P P PP PP P PP P P P + S S Sbjct: 80 ASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Query: 889 XXPPPXP 909 PP P Sbjct: 140 SSSPPLP 146 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.9 bits (74), Expect = 0.15 Identities = 29/123 (23%), Positives = 35/123 (28%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP SP R P +S PP P PPP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIY 562 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 + P ++P P ++ P P P PP P P P Sbjct: 563 SSPPPVVNCP--PTTQSPPPPKYEQTPSPREYYPSP--SPPYYQYTSSPPPPTYYATQSP 618 Query: 902 XXP 910 P Sbjct: 619 PPP 621 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/97 (22%), Positives = 26/97 (26%), Gaps = 1/97 (1%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXF-PXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRX 705 +P PPP P P + P P + P P P PP Sbjct: 674 SPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSP 733 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP 816 + P P PP PA PPP Sbjct: 734 PPPSPVYY-PPVTQSPPPPSTPVEYHPPASPNQSPPP 769 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 33.5 bits (73), Expect = 0.20 Identities = 27/106 (25%), Positives = 28/106 (26%), Gaps = 2/106 (1%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGF--LXPPXXXPXXXXPSXXPPXXXRX 705 P PPP P P P P + PP P PS PP Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP P P PPP P P P Sbjct: 156 PTPT------PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP 195 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P +PP P T P P P PP S + S P P P Sbjct: 86 PTPSVPSPTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P +PP P T P P P PP S + S P P P Sbjct: 104 PTPSVPSPTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 6/95 (6%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTP-PXXPAKTXXXPPPX 819 PP P PS PP P P PP TP P P+ T PP Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTP---SVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Query: 820 PXP-----XXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP + S P P P Sbjct: 156 PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 736 PXAXXPXPP--PXGTPPXXPAKTXXXPP-PXPXPXXXPPXXGGSXXTXFSSXSXXXPPPX 906 P + P P P TPP P P P P P PP + + PPP Sbjct: 80 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 139 Query: 907 P 909 P Sbjct: 140 P 140 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 33.1 bits (72), Expect = 0.26 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP 828 P PPP PP P PPP P P Sbjct: 1102 PLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGT-PPXXPAKTXXXPPPXPXPXXXPP 843 P + P PPP PP P + PPP P PP Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP +PP P+ + PPP PP S PPP P Sbjct: 1071 PLPPLPPSPPPPSPPLPPS-SLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PP P P PP PP PA PP P PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 662 PXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXP 841 P PPP + P P P P A P P PP P PL P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPP---PPPLSPP 1118 Query: 842 P 844 P Sbjct: 1119 P 1119 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/58 (27%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP--XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P +PP P PPP P P PP + PPP Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP P PPP P P PP Sbjct: 260 PGRSAPPPPPAAAPPPQP-----PPPPPPKPQPPPP 290 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 757 PPPXGTPPXXPAKT-XXXPPPXPXPXXXPP 843 PP PP PA PPP P P PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 P PPP P P PPP P P G + Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNT 312 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PP P PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +2 Query: 644 PPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXP 823 PP A PPP S P P P AP P PP P Sbjct: 100 PPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAP 159 Query: 824 XPLXXPPXXGXA 859 P+ PP A Sbjct: 160 SPISLPPAPAPA 171 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPP--PXPXPXXXPPXXGGSXXTXFS-SXSXXXPPPXP 909 P P P +PP A T PP P P P PP S + PPP P Sbjct: 96 PPPQPPQSPPAS-APTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/58 (25%), Positives = 16/58 (27%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P PP + P P P PP S P P P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG W G GG GGG G Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGGGEWGGGGEG 77 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/67 (25%), Positives = 19/67 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P P+ P F P P PPP + P P P P Sbjct: 32 PTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPP 91 Query: 823 XPXXXPP 843 P PP Sbjct: 92 PPDAPPP 98 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP----XXGGSXXTXFSSXSXXXPPPXPXA 915 P PP PP PA PP P P PP GG PP P A Sbjct: 118 PPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSA 176 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PPP TPP PPP P P T PP P A Sbjct: 72 PLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPA 131 Score = 28.3 bits (60), Expect = 7.5 Identities = 25/105 (23%), Positives = 27/105 (25%), Gaps = 4/105 (3%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPP-XXXXPXAXXXXPPPXSXVXXXXX 718 PPP P PP P P PP P PPP S Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Query: 719 GPFXXXLXRXXPGPXP---RAPLXPXXQKPXXPPXXXPXPLXXPP 844 P P P +P P +P PP PP Sbjct: 97 PPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPP 141 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 775 PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P PPP P P PP S PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/76 (28%), Positives = 24/76 (31%) Frame = +1 Query: 616 PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAK 795 PLF + PP P P PP P PPP T P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVE------TGIPPPPPPVTDMIKPLS 89 Query: 796 TXXXPPPXPXPXXXPP 843 + PPP P P PP Sbjct: 90 S--PPPPQPPPRSQPP 103 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P PPP P P PP S T PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPP------PPPPPPPPPPPPAVNMSVETGI------PPPPPP 80 Score = 30.3 bits (65), Expect = 1.9 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 2/83 (2%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P P G+ PP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP 103 Query: 722 PF--XXXLXRXXPGPXPRAPLXP 784 P L R P P PR+P P Sbjct: 104 PKPPQKNLPRRHP-PPPRSPEKP 125 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPPXXGG 855 P P PPP +P P P T P P P P P G Sbjct: 110 PQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPG 150 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS--XXTXFSSXSXXXPPPXP 909 PPP T P P+ PP P PP S S PPP P Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 28.3 bits (60), Expect = 7.5 Identities = 27/106 (25%), Positives = 27/106 (25%), Gaps = 1/106 (0%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXX-PPXXXRX 705 TP PPP P P P P PP P P PP Sbjct: 31 TPSAPPPVTPPPSPPQSPP----PVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVAS 86 Query: 706 XXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P TPP P PPP P P Sbjct: 87 SPPPPVVIASP----PPSTPATTPPAPPQTVSPPPPPDASPSPPAP 128 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXX----PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PP PP P PPP P PP T SS PPP Sbjct: 36 PPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASS----PPPP 91 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/95 (23%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXX------PAKTXX 804 PP P S PP P P P +PP P T Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPA 103 Query: 805 XPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P PP + + + + PPP P Sbjct: 104 TTPPAPPQTVSPPPPPDASPSP-PAPTTTNPPPKP 137 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P+ PP P P PP PP P K PP P Sbjct: 145 PPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKP 204 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP PP P K PP P PP Sbjct: 146 PVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPP 181 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP T P T PPP P PP S + P P P Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/57 (28%), Positives = 17/57 (29%), Gaps = 1/57 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP-PXXGGSXXTXFSSXSXXXPPP 903 P P P TPP P + PP P P P G PPP Sbjct: 69 PPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP +PP P +T PPP P P PP Sbjct: 365 PVPPPRRSPP--PLQT-PPPPPPPPPLAPPP 392 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXP 822 PPP TPP P PPP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P TPP K PP P P P PP + + P P P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXX---PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPX 906 P P P P TPP PA T P P P P P + + PP Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPK 85 Query: 907 P 909 P Sbjct: 86 P 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP-PXXGG 855 P P P P TPP P P P P P P GG Sbjct: 92 PTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP PP + PPP P P PP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPP 36 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP 822 P PPP G PP P PPP P Sbjct: 682 PPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P A P P PP P PPP P PP G Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 P PPP G P P PPP P GG+ Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGN 716 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 31.9 bits (69), Expect = 0.61 Identities = 22/87 (25%), Positives = 24/87 (27%), Gaps = 3/87 (3%) Frame = +1 Query: 658 PXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXX 837 P P PP P P PP +PP P+ PPP P Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSS 465 Query: 838 PPXXGGSXXTXFS---SXSXXXPPPXP 909 PP S PPP P Sbjct: 466 PPPPSPEFEGPLPPVIGVSYASPPPPP 492 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP T PPP P P G + PPP P Sbjct: 621 PLPPPL--PPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAP 671 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 31.5 bits (68), Expect = 0.81 Identities = 33/124 (26%), Positives = 36/124 (29%), Gaps = 4/124 (3%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXP---FFXG-VSWXPPXXXXPXAXXXXPPPXSXVXX 709 PPP PP P G P G +S PP P PP + Sbjct: 172 PPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLSNGPPPPMMGP 231 Query: 710 XXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXX 889 G F + GP AP P Q P P PL PP FP Sbjct: 232 ---GAFPRG-SQFTSGPM-MAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPY 286 Query: 890 XXPP 901 PP Sbjct: 287 GRPP 290 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.5 bits (68), Expect = 0.81 Identities = 29/126 (23%), Positives = 31/126 (24%), Gaps = 3/126 (2%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXX-PSXXPPXXXRXXXQX 717 PP P P P P + PP P P PP Sbjct: 85 PPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTT 144 Query: 718 XXFXGXPXAXXPXPPPXGTPPXXPAKTXXX--PPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 P PPP PP P T PP P PP T + Sbjct: 145 KPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPV 204 Query: 892 XPPPXP 909 PP P Sbjct: 205 ITPPTP 210 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/94 (23%), Positives = 25/94 (26%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P+ + PP P P+ PP Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTP----PTPTPPVITPPTPTPP 213 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP TPP T P P P Sbjct: 214 VITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXP---PPXPX-PXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P P TPP T P PP P P PP T + PP Sbjct: 159 PPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPP 218 Query: 904 XP 909 P Sbjct: 219 TP 220 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 31.5 bits (68), Expect = 0.81 Identities = 26/109 (23%), Positives = 29/109 (26%), Gaps = 4/109 (3%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXX--GXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQ 714 PPP P P +P P+ + PP P P P Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGL 153 Query: 715 XXXFXGXPXAXXPXPPPXGT-PPXX-PAKTXXXPPPXPXPXXXPPXXGG 855 P P P G PP P PP P PP GG Sbjct: 154 LPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPPSGGG 202 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 8/64 (12%) Frame = +1 Query: 736 PXAXXPXPPPXG--------TPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 P P PP G PP K PPP PP GG S Sbjct: 33 PHPPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVV 92 Query: 892 XPPP 903 PPP Sbjct: 93 RPPP 96 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.5 bits (68), Expect = 0.81 Identities = 31/123 (25%), Positives = 34/123 (27%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P S P + S PP P PPP Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPP--PPPYVYKSPPPP----PYVYSSPPPPPYVYKSPPPP 133 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P+ P P P K PP P PP + P P PP Sbjct: 134 PYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP--PPYVYSSPP 191 Query: 902 XXP 910 P Sbjct: 192 PPP 194 Score = 30.3 bits (65), Expect = 1.9 Identities = 32/124 (25%), Positives = 34/124 (27%), Gaps = 1/124 (0%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P SP P + S PP P PPP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPP--PPPYVYQSPPPP----PYVYSSPPPPPYVYKSPPPP 203 Query: 722 PFXXXLXRXXPGPXPRAPLXP-XXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXP 898 P+ P P P P PP P PP P P P Sbjct: 204 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP---PPPPYVYSSPPPPPYVYKSP 260 Query: 899 PXXP 910 P P Sbjct: 261 PPPP 264 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PP +PP P PPP P PP Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYSSPP 191 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 757 PPPXGTPP--XXPAKTXXXPPP-XPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP TPP PA T PP P P PP S SS + PP P Sbjct: 34 PPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSP----SSDAPTASPPAP 83 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 P GG G G GGG + G GG G G G Sbjct: 112 PGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GGV GGG G Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGG 183 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG W GG G G G G Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGG 169 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PPP P P+ PP P P PP GG PPP Sbjct: 370 PPPPVPAPQMPSSAG---PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PP PP PPP P PP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PPP PP PP P PP Sbjct: 383 AGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PPP P P+ PP P P PP GG PPP Sbjct: 370 PPPPVPAPQMPSSAG---PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PP PP PPP P PP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PPP PP PP P PP Sbjct: 383 AGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 683 PPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAX 862 PPP P L R P P PL P PP P P PP + Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPPKTKCSL 78 Query: 863 XP 868 P Sbjct: 79 KP 80 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P P PP + P P + PPP P P P G Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAG 61 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP----XXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP + PPP P P PP + PPP P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GGV GGG G A G Sbjct: 59 GGIGVGGGGGGGGG---IGGSGGVGAGGGVGGGAGG 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG G GG GGG G G Sbjct: 347 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG 381 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG G GG GGG G G Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG 463 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G G GGG G G Sbjct: 77 GGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKG 112 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G G G G G V GGG G G Sbjct: 245 GGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGG 280 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GG G GGV GGG G Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGG 491 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GG G GG GGG G G Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGG 313 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP +PP T PPP PP Sbjct: 111 PPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPP 146 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +1 Query: 646 PXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPX 825 P P P PP R F P P PP PP P + PPP P Sbjct: 56 PPPFPALFPPE--PPLPPRFELPPPLFPPPPLPRLP--PPLLPPPEEPPR--EPPPPPPP 109 Query: 826 PXXXPP 843 P PP Sbjct: 110 PEEPPP 115 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 6/73 (8%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXX----FXGXPXAXXPXPPPXGTPP--XXPAKTXX 804 PP P P PP F P P P P PP P + Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPR 101 Query: 805 XPPPXPXPXXXPP 843 PPP P P PP Sbjct: 102 EPPPPPPPPEEPP 114 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/80 (28%), Positives = 24/80 (30%) Frame = +2 Query: 662 PXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXP 841 P + PPP PF P P PR L P P P P PL P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP-PRFELPPPLFPPPPLPRLPP-PLLPP 95 Query: 842 PXXGXAXXPGFPXXXXXXPP 901 P P P PP Sbjct: 96 PEEPPREPPPPPPPPEEPPP 115 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP +P + + PP P PP S S PPP P Sbjct: 69 PPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 121 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P P P P P PP P P+ PP P P PP Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVP-PIWEPPRPPDIFPPESPPPGIDPPP 180 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PP PP P+ + PPP P P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PPP P P PPP P P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXP 828 PPP PP P PPP P P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/80 (27%), Positives = 25/80 (31%), Gaps = 10/80 (12%) Frame = +1 Query: 619 LFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPX--AXXPXPPPX-------- 768 + S+ F PP P PP + P A P PPP Sbjct: 187 MVSKSFAPPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPPPLPMAVRKGV 246 Query: 769 GTPPXXPAKTXXXPPPXPXP 828 PP P T PPP P P Sbjct: 247 AAPPLPPPGTAALPPPPPLP 266 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +1 Query: 724 FXGXPXAXXPXP---PPXGTPPXX-PAKTXXXPPPXPXPXXXPPXXGG 855 F G P A P P PP G P P PP P PP GG Sbjct: 13 FHGYPPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGG 60 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/60 (30%), Positives = 21/60 (35%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PPP P P PPP P PP + + + PPP P A Sbjct: 129 PVLLSPPPPPVNLSP-PPPPVLLSPPPPPV-LFSPPPPTVTRPPPPPTITRSPPPPRPQA 186 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP P P PPP PP S + S PPP P Sbjct: 66 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLS---PPPPP 120 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXG-TPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP +PP P PPP PP Sbjct: 57 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXG-TPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP +PP P PPP PP Sbjct: 93 PVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP P P T PPP P PP + PPP P Sbjct: 147 PVLLSPPPPPVLFSP--PPPTVTRPPPPPTITRSPPPPRPQAAAYYKK----TPPPPP 198 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 758 PXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXP-PXXP 910 P P P P P PP P+ PP G P P P P P Sbjct: 335 PLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIP 386 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPP--XPXPXXXPP 843 PPP TPP PPP P P PP Sbjct: 43 PPPVATPPPAATPAPATPPPAATPAPATTPP 73 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 PPP TP P P P PP G + S+ P P A Sbjct: 60 PPPAATPAPATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPGPSDASPAPSA 112 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP ++ PPP P PP F S PPP P Sbjct: 9 PPPPP---PPPPSFRSIPRPPPPPSFRSIPP-----RRHFFKKKSKSLPPPPP 53 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 751 PXPPPXGT---PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P K PPP P PP G+ S PP P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPP-----PPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/51 (27%), Positives = 16/51 (31%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P +PP P + PPP P P P PPP Sbjct: 376 PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 >At5g51600.1 68418.m06397 microtubule associated protein (MAP65/ASE1) family protein low similarity to SP|P50275 Anaphase spindle elongation protein {Saccharomyces cerevisiae}, protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 707 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -2 Query: 137 EIHCKFM*IQRRTLRHKRRCTDHLMCNYQECQILRIPYSESV 12 E+HC+ +Q+ + HL Y C +L + ++E V Sbjct: 165 ELHCQLQVLQKEKIDRVETIRKHLCTLYSHCSVLGMDFNEVV 206 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P + PPP +PP P PP P P P Sbjct: 27 PPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYP 61 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PS PP F P P PP P PPP P P P Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG GGG G G Sbjct: 98 GGYASGAGEGGGGG--YGGAAGGHAGGGGGGSGGGG 131 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -2 Query: 914 AXGXGGGXXXEXEENXVXXLPPXXG-GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAX 738 A G GGG G G G G GGG AG GG GG G A Sbjct: 164 AYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAY 223 Query: 737 G 735 G Sbjct: 224 G 224 >At5g44700.1 68418.m05477 leucine-rich repeat transmembrane protein kinase, putative Length = 1252 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 365 SRLNNTSIYGSRFKDHFPIALAEPKDLDR-RARFDDPVTNVPAHFFN 228 +RL YG+R P ++ KDL R R ++ V N+PA N Sbjct: 457 TRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGN 503 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP +PP P P P P PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 27.9 bits (59), Expect = 9.9 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXX-PAKTXXXPPPX 819 PP P P PP R F P P PPP PP P PPP Sbjct: 45 PPYRSPVTIPPP--PPVYSRPVA----FPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPI 98 Query: 820 PXPXXXP 840 P P Sbjct: 99 YSPPPTP 105 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +1 Query: 736 PXAXXPXPP----PXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP P PP P + PP P P PP Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPP 89 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP + PPP P P Sbjct: 560 PPTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQEP 595 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 29.1 bits (62), Expect = 4.3 Identities = 28/124 (22%), Positives = 31/124 (25%), Gaps = 1/124 (0%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P + PP P PP Sbjct: 169 PPPLELPPFLKKPCPPKYSPPVEVPPPVPV-YEPPPKKEIPPPVPVYDPPPKKEVPPPVP 227 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFS-SXSXXXP 897 + P P P P P P K PPP P P + P Sbjct: 228 VYKPPPKVELPPPIPKKPCPPKPPK-IEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHP 286 Query: 898 PPXP 909 PP P Sbjct: 287 PPVP 290 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 PPP G PP PPP P P PP G Sbjct: 21 PPPVGVPPQY-----YPPPPPPPPPPPPPRKVG 48 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P G PP PPP P P PP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 4/71 (5%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT-PPXXPAK---TXXXP 810 PP P P P P PPP + PP P K T P Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLP 149 Query: 811 PPXPXPXXXPP 843 PP P PP Sbjct: 150 PPTPKKSPPPP 160 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 751 PXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P TP P PA PPP P PP S PPP P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKS-PSPPPTP 132 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +1 Query: 757 PPPXGTP--PXXPAKTXXXPPPXPX---PXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP G P P+++ PPP P PP G + SS S P P Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPPPDSYSEPIPPPPDNGHVASSLSSDSLGVPYTVP 563 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P PPP PP PPP P P P Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAK-TXXXPPPXPXPXXXPP 843 P PPP PP P + PP P P PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP +PP P PPP P S S PPP P Sbjct: 37 PPPPPVYSPPISP---PPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P A P PP PP P PPP P Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P A P PP PP P PPP P Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P A P PP PP P PPP P Sbjct: 92 PQAFLPHLPPHHLPPPFPGPYDSAPPPPP 120 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/78 (24%), Positives = 22/78 (28%) Frame = +1 Query: 676 SXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 S PP + P PP +PP PPP P PP Sbjct: 351 SSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPY---AYSPPPPCPDVYKPPPYVYS 407 Query: 856 SXXTXFSSXSXXXPPPXP 909 S + PPP P Sbjct: 408 SPPPYVYNPPPSSPPPSP 425 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 28.7 bits (61), Expect = 5.7 Identities = 24/98 (24%), Positives = 31/98 (31%), Gaps = 2/98 (2%) Frame = +1 Query: 616 PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAK 795 P++++ + PP P P+ PP + PPP TPP Sbjct: 83 PVYTKPTIPPPVYTPPVYKPTLSPPVYTKPTI---------------PPPVYTPPVYKPT 127 Query: 796 TXXXPPPXPXPXXXPP--XXGGSXXTXFSSXSXXXPPP 903 P P P PP S S S PPP Sbjct: 128 PVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSPPP 165 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP +PP P PP P P P + T ++ S PPP P Sbjct: 68 PPSPSPPPPP-------PPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPP 110 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.7 bits (61), Expect = 5.7 Identities = 25/99 (25%), Positives = 27/99 (27%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PPP P PP P P P PP P P P + + Sbjct: 40 PSSPPPSPSTNSTSPP-PSSPLPPSLPPP-------SPPGSLTPPLPQ--PSPSAPITPS 89 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXP 829 P R P P P P P P P P Sbjct: 90 PPSPTTPSNPRSPPSPNQGPPNTPSGSTPRTPSNTKPSP 128 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 775 PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P PPP P P GGS S PPP P Sbjct: 217 PPPKPPSPPRKPPPPPPPPAFMSSSGGSDY----SDLPVLPPPSP 257 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/62 (25%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP--PXXGGSXXTXFSSXSXXXPPP 903 G + P PP + P PPP P P P + S PPP Sbjct: 8 GTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPP 67 Query: 904 XP 909 P Sbjct: 68 SP 69 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 A P P +PP P + PP P PP S S + PPP Sbjct: 4 APSPGTTPSPSPPSPPTNSTTTTPP-PAASSPPPTTTPSSPPPSPSTNSTSPPP 56 >At3g24250.1 68416.m03044 glycine-rich protein Length = 137 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = -2 Query: 902 GGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXP 729 GGG + P GG G GG F G GG P GGG + G P Sbjct: 82 GGGSGGSGMTFPLPSGTPLLGGAGGLGGLGGAMG--FPGGLGGGPSGGGVPSSSGGSP 137 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 751 PXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 P PPP G P PA+ PPP P GGS Sbjct: 461 PSPPPRRAGLPSPPPAQRLPSPPPRRAGLPSPMRIGGS 498 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXF 873 A P P P P PA T P P P P GG+ T F Sbjct: 308 APAPSPAPASAPVPAPAPT---PAPAPAPPNKVEALGGNGGTIF 348 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXF 873 A P P P P PA T P P P P GG+ T F Sbjct: 308 APAPSPAPASAPVPAPAPT---PAPAPAPPNKVEALGGNGGTIF 348 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 854 PPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 PP G G G GG G GG P GGG G G Sbjct: 87 PPLYGTTPPGGGDVGGGG---GGYGGGTPGGGGGGGGDTG 123 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/56 (26%), Positives = 19/56 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PP +PP T PPP PP + + + PPP Sbjct: 73 PLTDSPPPPSDSSPPVD--STPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPP 126 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/55 (29%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP--XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP +PP PA PP P PP T + P P P Sbjct: 147 PESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFP 201 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWV------FAGXXGGVPXGGGXGXXA 741 GG G G G G W+ F G GG GGG G A Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGA 99 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/61 (27%), Positives = 19/61 (31%), Gaps = 8/61 (13%) Frame = +1 Query: 751 PXPPPXGTPPXXPA--------KTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPX 906 P PPP P P + PPP P P PP G + F P Sbjct: 357 PPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPPSSFQDGQAMIRPYV 416 Query: 907 P 909 P Sbjct: 417 P 417 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P PP Q P PPP P PPP P PP G Sbjct: 182 PYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPG 241 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXKXXXCXXXRXXWGGXXXG 672 GG GGG + G GG GGG G G P R GG G Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGG-KKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/74 (24%), Positives = 21/74 (28%), Gaps = 3/74 (4%) Frame = +1 Query: 616 PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPX---GTPPXX 786 P + PP P PP + Q P P PP PP Sbjct: 308 PTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNP 367 Query: 787 PAKTXXXPPPXPXP 828 P + PPP P Sbjct: 368 PRQPPSHPPPGSAP 381 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP 822 P PP PP P +T PPP P Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPP 180 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG F G GG GGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGG---GGGHG 39 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPP-----PXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P P KT PP P PP + SS S PPP Sbjct: 473 PSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSPLSSKSMLPPPP 526 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSS--XSXXXPPPXPXA 915 P PPP PP + PP P P S + SS S PPP A Sbjct: 196 PPPPPTPRPPRLLSSQPAPPPTPPVSLPSPSMVVSSSSSSNSSATNSMYNPPPSSTA 252 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXP---PPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PPP T P P KT P PP P PP + S PP Sbjct: 234 PPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPP 285 >At4g21620.1 68417.m03134 glycine-rich protein Length = 131 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGG 759 P G G G GGG F G GG GG Sbjct: 44 PGFGNGFPGTGVGGGYGGGFGGPSGGFGKGG 74 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGG 759 GG G G GGG G GG P GG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 PPP PP P + PPP P P P Sbjct: 92 PPPSPPPPSPPPPSQACPPP-PLPPSPP 118 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +1 Query: 736 PXAXXPXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXF--SSXSXXXPPPX 906 P P PP G P P P P P P P G + + F S PPP Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYP-PHQPPFNAGANGNSQFPPPSTGAPIPPPY 117 Query: 907 PXA 915 P A Sbjct: 118 PQA 120 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +1 Query: 736 PXAXXPXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXF--SSXSXXXPPPX 906 P P PP G P P P P P P P G + + F S PPP Sbjct: 59 PSPPPPPPPQWGPPSPHYPQGQPYSSPAYP-PHQPPFNAGANGNSQFPPPSTGAPIPPPY 117 Query: 907 PXA 915 P A Sbjct: 118 PQA 120 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/58 (27%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPP--XXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXP 897 G P P PP PP P + PP P PP G + S P Sbjct: 23 GYPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/75 (26%), Positives = 21/75 (28%) Frame = +3 Query: 690 PXPPXXXTXXXLXRXXSGGGPXAPXXGHPSXPXXKNPXXPPXXXXSXXXSPPXGGXXXXX 869 P PP GP AP S + P PP S PP G Sbjct: 215 PPPPPRSMYDRASNYGLPSGPSAPVDAFSSIDHKQPPLAPP--RFSNYGPPPSGPSAPVD 272 Query: 870 VFLXLXXXPPPXPPG 914 FL P P G Sbjct: 273 AFLVTEYKPQAPPMG 287 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,592,065 Number of Sequences: 28952 Number of extensions: 368310 Number of successful extensions: 4926 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2532 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -