BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N03 (871 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 26 0.44 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 4.1 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 21 9.5 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 25.8 bits (54), Expect = 0.44 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 203 GARVVPGAAREPRHRPAH 256 G R PG AR RH PAH Sbjct: 327 GGRRGPGPARSRRHLPAH 344 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 301 CGISRPTTWRPCNTGTSDPRSWWEVTARCTRAPAGCTSAR 420 C +PT WR C+ T + + + + R +G T+AR Sbjct: 878 CENGKPTCWRECDKATCE-KLFRMKKSSALRPASGGTTAR 916 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.8 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 23 LGNPLRFRYARVLDVLARA--APRHGPPPLGSCTRARSQLASHRNSSRLRRRQ*KAMGRF 196 +G PL + + D R A +GP G TRA LA + R+++R Sbjct: 2561 MGMPLYGQSFSLADAADRGLNAKSYGPGEAGEFTRAGGFLAYYEICERVKKRGWTVTR-- 2618 Query: 197 DPGARVVPGA 226 DP R+ P A Sbjct: 2619 DPQGRIGPYA 2628 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = -1 Query: 193 PSHCFLLTTSQSAAISVRSELRASASTTAEWRRAMSRSGACQH 65 P HC A I+V++ + ++ S A W+ + +G ++ Sbjct: 1191 PIHCQTEQDVPEAPIAVKALVMSTDSILASWKPPVEPNGIVEY 1233 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 294 ELVRNIQTNHMEALQYWD 347 EL + +TN M+ +Q+W+ Sbjct: 230 ELPQQHKTNVMDVMQWWE 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,056 Number of Sequences: 336 Number of extensions: 2903 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -