BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N03 (871 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 33 0.30 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 4.9 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 4.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.9 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 4.9 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) 29 4.9 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 4.9 SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_44812| Best HMM Match : DUF586 (HMM E-Value=6.5) 29 6.5 SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) 29 6.5 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 23 7.7 SB_41722| Best HMM Match : Extensin_2 (HMM E-Value=0.35) 28 8.6 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 9.3 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPPXXXXXXXPXXXXXXXXXXXXXXXXPPXXPP 870 PPP PPPP P PP P PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPP 414 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPP 415 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPP 416 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPP 417 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPP 418 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 404 PPPPPPPPPPPPPPPAPP 421 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPP 422 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 406 PPPPPPPPPPPPPAPPPP 423 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 408 PPPPPPPPPPPAPPPPPP 425 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 409 PPPPPPPPPPAPPPPPPP 426 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 410 PPPPPPPPPAPPPPPPPP 427 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 411 PPPPPPPPAPPPPPPPPP 428 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 730 PPXPPPPXXXXPXXXPPXXXXXXXPXXXXXXXXXXXXXXXXPPXXPP 870 PP PPPP P PP P PP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPP 700 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 684 PPPPPPPPPPPPPPPPPP 701 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 691 PPPPPPPPPPPQPSTPPP 708 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 694 PPPPPPPPQPSTPPPPPP 711 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 867 PPPPPPPPPPPPPPPPPP 884 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 868 PPPPPPPPPPPPPPPPPP 885 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPP 481 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPP 482 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPP 483 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPP 484 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPP 485 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPP 486 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 470 PPPPPPPPPPPPPPPPPP 487 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 473 PPPPPPPPPPPPPPPFPP 490 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 474 PPPPPPPPPPPPPPFPPP 491 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 475 PPPPPPPPPPPPPFPPPP 492 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 477 PPPPPPPPPPPFPPPPPP 494 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 83 PPPPPPPPASNVPAPPPP 100 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 195 PPPPPPPPPPGFPGGAPP 212 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 400 PEPSYTLPLPPTRNEGPMSQYC 335 P P + P PP N GP +YC Sbjct: 214 PPPPFGAPPPPALNGGPPREYC 235 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 1159 PPPPPPPPPPSSPSPPPP 1176 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 1161 PPPPPPPPSSPSPPPPPP 1178 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 1311 PPPPPPPPPPPPPPPLPP 1328 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 363 PPPPPPPPVGGPPPPPPP 380 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPPXXXXXXXPXXXXXXXXXXXXXXXXPPXXPP 870 PPP PPPP P P P PP PP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 >SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 684 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 331 PCNTGTSDPRSWWEVTARCTRAPAGCTSARTPTGTTRGPS 450 P N G SD SW + CT++ +G T RT T T PS Sbjct: 410 PVNGGWSDYSSW----SSCTKSCSGGTRTRTRTCTNPKPS 445 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 727 PPPXPPPPXXXXPXXXPP 780 PPP PPPP P PP Sbjct: 215 PPPPPPPPSPSPPRPPPP 232 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +1 Query: 331 PCNTGTSDPRSWWEVTARCTRAPAGCTSARTPTGTTRGPS 450 P N G SD SW + CT++ G T RT T T PS Sbjct: 379 PVNGGWSDYSSW----SSCTKSCGGGTRTRTRTCTNPKPS 414 >SB_44812| Best HMM Match : DUF586 (HMM E-Value=6.5) Length = 520 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +1 Query: 286 AARSSCGISRPTTWRPCNTGTSDPRSWWEVTARCTRAPAGCTSARTPTGTTRGPS 450 + R S G S TWR + T +P C A CT T T+RG S Sbjct: 138 SGRPSPGSSSTPTWRSGKSYTQEPNRLASSWRSCCATAAACTPLTTQE-TSRGSS 191 >SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 446 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +1 Query: 331 PCNTGTSDPRSWWEVTARCTRAPAGCTSARTPTGTTRGPS 450 P N G SD SW + CT++ G T RT T T PS Sbjct: 294 PVNGGWSDYSSW----SSCTKSCGGGTRTRTRTCTNPKPS 329 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 727 PPPXPPPP 750 PPP PPPP Sbjct: 280 PPPPPPPP 287 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 733 PXPPPPXXXXPXXXPP 780 P PPPP P PP Sbjct: 301 PPPPPPTDFAPPPPPP 316 >SB_41722| Best HMM Match : Extensin_2 (HMM E-Value=0.35) Length = 343 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = -2 Query: 372 LPPGTRVRCP---SIARPPCGWSGYSARAPRSQR 280 +PPGTR R P + ARPP AR PR QR Sbjct: 214 IPPGTRARSPVDSAKARPPV--DSARARYPRRQR 245 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 727 PPPXPPPP 750 PPP PPPP Sbjct: 721 PPPAPPPP 728 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 730 PPXPPPPXXXXPXXXPP 780 PP PPPP PP Sbjct: 755 PPPPPPPAVPGEGARPP 771 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,522,511 Number of Sequences: 59808 Number of extensions: 442680 Number of successful extensions: 2749 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2239 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -