BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N02 (838 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27370.1 68417.m03929 myosin family protein contains Pfam pro... 31 0.95 At4g15840.1 68417.m02409 expressed protein 29 2.9 >At4g27370.1 68417.m03929 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif Length = 1126 Score = 31.1 bits (67), Expect = 0.95 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 80 LNFLNQHSSFYTCAIARREQKLKEH-GASSCISGKRGR 190 ++ LN+ S+F KLK+H A+SC G+RGR Sbjct: 590 VSLLNEESNFPKATDTTFANKLKQHLNANSCFKGERGR 627 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 230 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 322 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,191,535 Number of Sequences: 28952 Number of extensions: 244234 Number of successful extensions: 470 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -