BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G18 (453 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 24 0.58 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 24.2 bits (50), Expect = 0.58 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 279 DPVCDPPCVNGVCKQPNVCQCNANYTDNP 365 DP PPC VC P+ C C+ + T P Sbjct: 156 DPNRAPPCDPAVCVLPD-CFCSEDGTTIP 183 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 115 ISSHIGDHFASWAQFAFINKLNIGMNGSINRNNL 216 + S IG + A W+ +L++ NG N NL Sbjct: 55 VYSFIGVNDADWSVLVIDPELDVDQNGFRNFTNL 88 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 115 YGTCTSSGTF 86 YGTC S G F Sbjct: 557 YGTCRSEGIF 566 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,642 Number of Sequences: 336 Number of extensions: 2866 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -