BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G11 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 3.3 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 7.6 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/43 (25%), Positives = 16/43 (37%) Frame = -3 Query: 567 FNLRNRKFPTRAIPTDFTTRCFLDSFQNSIRSTKPAWSRCTHL 439 F++ P R + D L + QN +KP R L Sbjct: 656 FDVFRNMLPVRNVSVDVRDNILLKNLQNPSTGSKPGKPRSAFL 698 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 371 ILGKFKISATLCMAEVGNHP 312 ++ KF+ + C +EVG P Sbjct: 106 VVSKFRAGFSECASEVGRFP 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,298 Number of Sequences: 336 Number of extensions: 2879 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -