BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_G11 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02580.1 68417.m00352 NADH-ubiquinone oxidoreductase 24 kDa s... 161 3e-40 At5g22330.1 68418.m02605 TATA box-binding protein-interacting pr... 32 0.32 At1g01450.1 68414.m00060 protein kinase-related contains eukaryo... 29 3.0 At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain... 28 5.2 At1g08260.1 68414.m00911 DNA-directed DNA polymerase epsilon cat... 28 5.2 At5g38070.1 68418.m04587 zinc finger (C3HC4-type RING finger) fa... 27 6.8 At1g48470.1 68414.m05418 glutamine synthetase, putative similar ... 27 6.8 At1g02940.1 68414.m00261 glutathione S-transferase, putative sim... 27 6.8 At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain... 27 9.0 At1g74710.2 68414.m08655 isochorismate synthase 1 (ICS1) / isoch... 27 9.0 At1g48650.1 68414.m05445 helicase domain-containing protein cont... 27 9.0 >At4g02580.1 68417.m00352 NADH-ubiquinone oxidoreductase 24 kDa subunit, putative similar to NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Polypeptide II) (Swiss-Prot:P04394) [Bos taurus] Length = 255 Score = 161 bits (391), Expect = 3e-40 Identities = 71/143 (49%), Positives = 103/143 (72%) Frame = +1 Query: 148 SLFVHRDTPEDNPSIPFEFTAPNQKRVEALLAIYPEGHKRGAMIPLLDLAQRXNGGWLPT 327 +L H D+P++ P +P+EF+ NQ +V+ +L+ YP +K+ A+IPLLDLAQ+ NGGWLP Sbjct: 31 ALNYHLDSPDNKPDLPWEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLAQQQNGGWLPV 90 Query: 328 SAMHKVAEILNLPRMRVYEVATFYTMFIRRPIGKYHVQVCTTTPCWLRGSDAVLKAIKEA 507 SAM+ VA+++ + +RVYEVATFY+MF R +GKYH+ VC TTPC +RGS + A+ + Sbjct: 91 SAMNAVAKVIEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRDIESALLDH 150 Query: 508 TGCEVGGNSPCGKFSVSEVECLG 576 G + G + G FSV E+EC+G Sbjct: 151 LGVKRGEVTKDGLFSVGEMECMG 173 >At5g22330.1 68418.m02605 TATA box-binding protein-interacting protein-related similar to TATA box-binding protein-interacting protein SP:O35753 from [ Mus musculus] Length = 458 Score = 31.9 bits (69), Expect = 0.32 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -3 Query: 168 VSVDEETVMLEGRSGLQTSRRHAPQGLNPS 79 ++VDEE ++L G G +TS RHA Q L+P+ Sbjct: 386 LTVDEECLVLLGEIGQRTSLRHAVQLLSPA 415 >At1g01450.1 68414.m00060 protein kinase-related contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 470 Score = 28.7 bits (61), Expect = 3.0 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 56 K*CYLASKLGFRPCGACLLEVCRPLLPSSMTVSSSTETPLKTTL-VSRLNLQRLIKRELK 232 K C+L +L + G + EVC P +++++ + + L+ L + L+ +R+ EL Sbjct: 92 KECFLVMELMRKTLGMHIKEVCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELN 151 Query: 233 PS 238 PS Sbjct: 152 PS 153 >At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related low similarity to clathrin assembly protein AP180 [Xenopus laevis] GI:6492344; contains Pfam profile PF01417: ENTH domain Length = 591 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 238 LAIYPEGHKRGAMIPLLDLAQRXNGGW 318 LAIYP GH+ A L L + GW Sbjct: 404 LAIYPPGHETSAPSNSLSLIEAGGSGW 430 >At1g08260.1 68414.m00911 DNA-directed DNA polymerase epsilon catalytic subunit, putative similar to SP|Q07864 DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7) (DNA polymerase II subunit A) {Homo sapiens}; contains Pfam profiles: PF03175 DNA polymerase type B, organellar and viral, PF00136 DNA polymerase family B, PF03104 DNA polymerase family B, exonuclease domain Length = 2271 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 468 KPAWSRCTHLYMILSYWSPNKHSIEC 391 +P WS HL + W N HS +C Sbjct: 1922 EPKWSVARHLPEYIEVWRQNPHSNQC 1947 >At5g38070.1 68418.m04587 zinc finger (C3HC4-type RING finger) family protein contains InterPro Entry IPR001841 Zn-finger, RING; contains PROSITE PS00190: Cytochrome c family heme-binding site signature Length = 259 Score = 27.5 bits (58), Expect = 6.8 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -3 Query: 222 LLIRRCKFKRDTRVVFRGVSVDEET 148 ++I+RC+ +RDTR+ G S DEET Sbjct: 217 IVIQRCRQERDTRL--SGFSSDEET 239 >At1g48470.1 68414.m05418 glutamine synthetase, putative similar to glutamine synthetase, cytosolic isozyme (glutamate-- ammonia ligase, GS1) [Arabidopsis thaliana] SWISS-PROT:Q9LVI8 Length = 353 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 241 AIYPEGHKRGAMIPLLDLAQRXNGGWLPTSAMHKVAEILNLPRMRVYE 384 AI+ + ++G I ++ A R G +PT+ HK +I + P ++ E Sbjct: 76 AIFKDPFRKGNNILVMCDAYRPAGDPIPTNNRHKAVKIFDHPNVKAEE 123 >At1g02940.1 68414.m00261 glutathione S-transferase, putative similar to glutathione S-transferase GI:860955 from [Hyoscyamus muticus] Length = 256 Score = 27.5 bits (58), Expect = 6.8 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 307 NGGWLPTSAMHKVAEILNLPRMRVYEVATFYTMFIRRPIGKYHVQVCTTTPCWLRGSD 480 N +L +++ +A++ +LP ++ MF+ RP + V T P W R D Sbjct: 190 NSSFLASNSF-TMADLYHLPNIQYLMDTHTKRMFVNRPSVRRWVAEITARPAWKRACD 246 >At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain B, Crystal Structure Of N-Terminal Domain Of Drosophila Ap180 (GP:13399617) [Drosophila melanogaster]; supporting cDNA gi|20465326|gb|AY096427.1| Length = 601 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 238 LAIYPEGHKRGAMIPLLDLAQRXNGGW 318 LAIYP GH+ +L L + GW Sbjct: 415 LAIYPPGHEAPGPSNILSLIETGGSGW 441 >At1g74710.2 68414.m08655 isochorismate synthase 1 (ICS1) / isochorismate mutase identical to GI:17223087 and GB:AF078080; contains Pfam profile PF00425: chorismate binding enzyme; contains TIGRfam profile TIGR00543: isochorismate synthases; identical to cDNA isochorismate synthase 1 precursor (ICS1) nuclear gene for plastid product GI:17223086 Length = 622 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 435 MILSYWSPNKHSIECCNFIHSHS 367 M+L Y +PN +S+ CC F S S Sbjct: 565 MVLCYQNPNFYSLFCCCFCSSPS 587 >At1g48650.1 68414.m05445 helicase domain-containing protein contains similarity to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00035: Double-stranded RNA binding motif Length = 1197 Score = 27.1 bits (57), Expect = 9.0 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +1 Query: 322 PTSAMHKVAEILNLPRMRVYEVATFYTMFIRRPIGKYHVQVCTTTPCWLRGSDAVLKAIK 501 P + M + R R ++ + ++ P G+ V T P + + DA+LKAI Sbjct: 255 PETVMQNSLARERILRPRSLQLKSKQQQWVDSPEGQKMVGFRKTLPAY-KEKDALLKAIA 313 Query: 502 EATGCEVGGNSPCGK 546 V G + CGK Sbjct: 314 ANQVVVVSGETGCGK 328 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,688,990 Number of Sequences: 28952 Number of extensions: 254494 Number of successful extensions: 717 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -