BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_F19 (460 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63410.1 68418.m07960 leucine-rich repeat transmembrane prote... 32 0.21 At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.49 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 29 1.5 At3g62160.1 68416.m06984 transferase family protein low similari... 29 1.5 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 28 2.6 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 6.1 >At5g63410.1 68418.m07960 leucine-rich repeat transmembrane protein kinase, putative contains similarity to receptor-like protein kinase Length = 680 Score = 31.9 bits (69), Expect = 0.21 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Frame = +1 Query: 28 YANYSNTFLYNNEEQRLTYLTEDIGFNSYYYYFHSHLPFWWSSERY---GNLKHRR--GE 192 Y + SN FL+ + +L+ + + F + +F+ LP W+ S Y + K + GE Sbjct: 145 YLDLSNNFLFGSVPPKLSTMVKLETFRFDHNFFNGTLPSWFDSYWYLKVLSFKSNKLSGE 204 Query: 193 IYYNFYQQLTTRYYFERLTNGLGSIPE 273 ++ + T Y R + GS+P+ Sbjct: 205 LHSSLLSLSTIEYIDLRANSLSGSLPD 231 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.49 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 312 GIVTSLNRRVPREFRYGTQAVCKT 241 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/59 (22%), Positives = 25/59 (42%) Frame = +1 Query: 175 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYFFPFAQRP 351 K +G F ++ + F + G + WY+P+ GY + ++F+P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 309 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 220 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 28.3 bits (60), Expect = 2.6 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +1 Query: 250 NGLGSIPEFSWYSPIKTGYYPLMTSYFFPFAQRPDNYNLHSVKNYEAIRFLDIFE 414 +GL +IP +W + +TG + F P D V NYE L+ F+ Sbjct: 1004 SGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFD 1058 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 6.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 395 GSWTFLKRLSYSPY 436 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,740,623 Number of Sequences: 28952 Number of extensions: 186296 Number of successful extensions: 531 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -