BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J11 (501 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory pro... 23 1.5 AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical pro... 23 1.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.6 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 8.2 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 8.2 >DQ855489-1|ABH88176.1| 122|Tribolium castaneum chemosensory protein 2 protein. Length = 122 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +1 Query: 277 NRHFYRRFLRWTFLFGICGHRVQFVADLVPDA 372 N+ + +L+ G C + D++PDA Sbjct: 36 NKRLFDNYLQCLLKKGKCNEEAAILRDVIPDA 67 >AJ973444-1|CAJ01491.1| 122|Tribolium castaneum hypothetical protein protein. Length = 122 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +1 Query: 277 NRHFYRRFLRWTFLFGICGHRVQFVADLVPDA 372 N+ + +L+ G C + D++PDA Sbjct: 36 NKRLFDNYLQCLLKKGKCNEEAAILRDVIPDA 67 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 3.6 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 288 LSPVSTLDFFIWNM 329 + P+STL +F W++ Sbjct: 562 IRPISTLGWFFWSL 575 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 20.6 bits (41), Expect = 8.2 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 149 FNNNDINSRAMVKTECSVRPVKAYIMSDLLKRFDYETTN 265 F+NN I R + S K M DLL ++ E N Sbjct: 244 FSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEGAN 282 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 20.6 bits (41), Expect = 8.2 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 149 FNNNDINSRAMVKTECSVRPVKAYIMSDLLKRFDYETTN 265 F+NN I R + S K M DLL ++ E N Sbjct: 244 FSNNVIAERKKHFSSSSYSSRKRLAMLDLLLKYKSEGAN 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,802 Number of Sequences: 336 Number of extensions: 2146 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -