BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J10 (283 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 29 0.76 SB_3857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_52939| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 SB_16663| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) 25 9.4 SB_57281| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) 25 9.4 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 28.7 bits (61), Expect = 0.76 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +3 Query: 48 CSTILCQPTGGRARLTEGCSFRRKQ 122 C ++CQ + ++R T+GC ++R++ Sbjct: 230 CEVLVCQRSDKKSRCTKGCPYQRRR 254 >SB_3857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 73 LVAELD*RKDVHLEENSIKSWRESRINFKIMFVSNNM 183 L +E+ RK+V + ++ W S + + VSNNM Sbjct: 198 LDSEMAERKEVTVYTTALSQWLSSMFTYPFVVVSNNM 234 >SB_52939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/16 (56%), Positives = 15/16 (93%) Frame = -3 Query: 197 KRHSFILLETNIILKL 150 KRH+F+L+E+NI+ +L Sbjct: 8 KRHAFMLMESNILHEL 23 >SB_16663| Best HMM Match : Keratin_B2 (HMM E-Value=0.61) Length = 385 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 27 RVVVCAGCSTILCQPTGGRARLTEGC 104 RVVV +GC C R +T GC Sbjct: 269 RVVVTSGCHQWFCHEWLSRVVVTSGC 294 >SB_57281| Best HMM Match : Keratin_B2 (HMM E-Value=1.1) Length = 319 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 27 RVVVCAGCSTILCQPTGGRARLTEGC 104 RVVV +GC C R +T GC Sbjct: 203 RVVVTSGCHQWFCHEWLSRVVVTSGC 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,825,045 Number of Sequences: 59808 Number of extensions: 124960 Number of successful extensions: 265 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 290602631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -