BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J09 (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) 249 1e-66 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 37 0.010 SB_54546| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) 29 2.7 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 29 3.6 SB_48231| Best HMM Match : TUDOR (HMM E-Value=1.9e-28) 28 4.7 SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) 28 4.7 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 6.2 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 28 6.2 >SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) Length = 212 Score = 249 bits (609), Expect = 1e-66 Identities = 115/151 (76%), Positives = 130/151 (86%) Frame = +2 Query: 119 EVDADLLGDEWKGYVLRVAGGNDKQGFPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKR 298 EV + LGDEWKGYV R+ GGNDKQGFPMKQG++TN RVRLL+SKGHSCYRPRR GERKR Sbjct: 2 EVSGECLGDEWKGYVFRITGGNDKQGFPMKQGIMTNGRVRLLLSKGHSCYRPRRTGERKR 61 Query: 299 KSVRGCIVDANLSVLALVIVRKGAQEIPGLTDGEVPRRLGPKRASKIRKLFNLKKEDDVR 478 KSVRGCIVD+ LSVL+LVIV+KG Q+IPGLTD +PRRLGPKR KIRK+FNL KEDDVR Sbjct: 62 KSVRGCIVDSQLSVLSLVIVKKGEQDIPGLTDNTIPRRLGPKRVGKIRKMFNLSKEDDVR 121 Query: 479 RYVVKRLLPAKEGKDNAKPRYKAPKIQRLVT 571 +YV++R LP KEGK K + KAPKIQRLVT Sbjct: 122 QYVIRRPLPEKEGK---KAKSKAPKIQRLVT 149 >SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) Length = 796 Score = 37.1 bits (82), Expect = 0.010 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -3 Query: 265 ARVAF*HQETYTAVSQDSLFHREALLVVTAGNTENITFPFVA*KICINFSAHTLFIE 95 A V QE A+ D L H ++L V+T + E+++ P + + HTL IE Sbjct: 250 AAVTLGEQEADAAIGHDPLLHGKSLFVITTSDPEDVSLPLIPQALPRYLHGHTLVIE 306 >SB_54546| Best HMM Match : zf-CCHC (HMM E-Value=0.0024) Length = 848 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +3 Query: 222 LTAVYVS*CQKATLATDHVVTVRGNASLFVVALLML 329 L+++ + C KATLA D+V++ +GN+ ++ L+L Sbjct: 472 LSSMLSNGCTKATLACDNVISEKGNSFQRILGSLIL 507 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 305 VRGCIVDANLSVLALVIVRKGAQEIPGLTDGEVPRRLGPKRASKIRK 445 VR C +D +VLA + + A E GLT+G V GP R +++ Sbjct: 86 VRSCPMDKQSTVLA--VETREACESKGLTEGCVSSAFGPGREEPVQE 130 >SB_48231| Best HMM Match : TUDOR (HMM E-Value=1.9e-28) Length = 1282 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 7/53 (13%) Frame = +2 Query: 392 DGEVPRRLGPKRAS-------KIRKLFNLKKEDDVRRYVVKRLLPAKEGKDNA 529 D ++PRR+ +R + K RK+F+L + + KRLLP G++ A Sbjct: 1206 DKDIPRRIKQERQNNRYTDHRKFRKVFSLPSRLKIPANLAKRLLPPPPGRNVA 1258 >SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) Length = 291 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 395 GEVPRRLGPKRASKIRKLFNLKKEDDVRRYVVK 493 G + GP + SKI K+ ++DDV+ VVK Sbjct: 221 GSEAAKTGPNKLSKIDKVILAVEDDDVQEIVVK 253 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +1 Query: 472 CASLCCKTPFTCQ--RGQGQC 528 CASL CK+P CQ +G+ QC Sbjct: 122 CASLRCKSPSRCQVIKGKPQC 142 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +2 Query: 377 IPGLTDGEVPRRLGPKRASKIRKLFNLKKEDDVRRYVVKRLLPAKEGKDNAKPR 538 + + D E P L A ++ + + DDV+ ++K L+P KEG ++ P+ Sbjct: 9 LDSMRDKEAPAVL----AGLVQNILDEDIPDDVKHRLLKPLVPEKEGPESLDPK 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,198,232 Number of Sequences: 59808 Number of extensions: 388644 Number of successful extensions: 1039 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -