BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J08 (487 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 36 3e-04 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 29 0.017 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 29 0.030 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 29 0.030 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 29 0.030 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 3.4 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 3.4 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 4.5 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 7.9 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 7.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 35.5 bits (78), Expect = 3e-04 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +3 Query: 264 TALRDPAFYQLYDRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVE 404 TA+RDP FY+ + I +K L Y + +L++ G+ ++++ V+ Sbjct: 392 TAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNYPGITVSNIEVQ 438 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 29.5 bits (63), Expect = 0.017 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 270 LRDPAFYQLYDRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVE 404 LRDP F++ + I FK L Y +L++ GV + ++ V+ Sbjct: 394 LRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNYPGVTVTNIEVQ 438 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 28.7 bits (61), Expect = 0.030 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 280 LHSISYMTGLWVTLTHSSIT 339 +H+ SYMTG+WV L + S T Sbjct: 123 IHTSSYMTGIWVWLINISAT 142 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +1 Query: 187 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYMTGLWVTL 321 +AMC + + + + S P L F P L W+ L Sbjct: 178 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 222 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.030 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 280 LHSISYMTGLWVTLTHSSIT 339 +H+ SYMTG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +1 Query: 187 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYMTGLWVTL 321 +AMC + + + + S P L F P L W+ L Sbjct: 411 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 28.7 bits (61), Expect = 0.030 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 280 LHSISYMTGLWVTLTHSSIT 339 +H+ SYMTG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = +1 Query: 187 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYMTGLWVTL 321 +AMC + + + + S P L F P L W+ L Sbjct: 411 IAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 AFKHYLKPYPQEKLHFVGVKI 386 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 AFKHYLKPYPQEKLHFVGVKI 386 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 AFKHYLKPYPQEKLHFVGVKI 386 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 324 AFKHYLKPYPQEKLHFVGVKI 386 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 22.6 bits (46), Expect = 1.9 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 284 CRVSKCGLVKVKRTGHE-GVLVEWFR 210 CR+ KC LV + ++G G WF+ Sbjct: 61 CRLRKCLLVGMSKSGSRYGRRSNWFK 86 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.6 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 471 LFWSRIHC*W 442 LFW++ HC W Sbjct: 2269 LFWNKDHCDW 2278 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 3.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 224 VEWFRCCTEHMASDNFIRSLIILCNFFFIQIGVL 123 ++W R +AS FI I LC+ + IG + Sbjct: 275 IKWTRIAYMALASVPFIFDSIHLCDVCYSTIGTV 308 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.8 bits (44), Expect = 3.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 224 VEWFRCCTEHMASDNFIRSLIILCNFFFIQIGVL 123 ++W R +AS FI I LC+ + IG + Sbjct: 293 IKWTRIAYMALASVPFIFDSIHLCDVCYSTIGTV 326 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 164 IILCNFFFIQIGVLLPIVSDKVNCLFIV 81 I C FF I +LL I + LFI+ Sbjct: 407 ITACKFFSIDNALLLSICGASSSYLFIM 434 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +3 Query: 357 EKLHFVGVKINDVVVEKLVTFFDYS 431 EK+ + N++V +++ F DY+ Sbjct: 134 EKIQALDPSTNELVFSEVLLFLDYN 158 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 96 LPFHRGNQFSCHTIRICL 43 + FH G+Q HT++ L Sbjct: 378 ITFHIGSQLVLHTVKTVL 395 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,951 Number of Sequences: 336 Number of extensions: 2468 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -