BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J08 (487 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 31 0.38 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) 29 2.0 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 2.0 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 4.7 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 6.2 SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) 27 8.2 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 27 8.2 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 31.9 bits (69), Expect = 0.29 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +3 Query: 246 ALDFYQTALRDPAFYQLYDRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 425 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 426 YSQ 434 Y Q Sbjct: 240 YGQ 242 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 31.5 bits (68), Expect = 0.38 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +1 Query: 208 HLNHSTSTPSCPVRLTFTKPHFETLHSISYMTGLWVTLTHSSIT*SLILKRNFISSALKS 387 +L HST T S L T T +++++T + TLTH +IT S I L Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 388 MMLSLRN*SHS-LTIANLMPLTV 453 + L+ +HS LT + L T+ Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTL 107 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 286 SISYMTGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 453 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 Score = 29.5 bits (63), Expect = 1.5 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +1 Query: 172 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYMTGLWVTLTHSSIT*S 345 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 346 LILKRNFISSALKSMMLSLRN*SH 417 + S + L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 29.1 bits (62), Expect = 2.0 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +1 Query: 175 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYMTGLWVTLTHSSIT* 342 + L+ + + L H T T S LT T H H +++++T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 343 SLILKRNFISSALKSMMLSLRN*SHS 420 S + S L ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.50 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 187 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 279 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) Length = 1119 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 189 RHVLGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYDRIVGYINAF 329 R +L P P ++ ++P DF+ +L D + D + YIN + Sbjct: 20 RRLLEVLPDPIEEDNYLPP--DFFYDSLADSPQFASLDELFNYINYY 64 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +3 Query: 36 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 167 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 363 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 455 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 51 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 191 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 >SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) Length = 1632 Score = 27.1 bits (57), Expect = 8.2 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +1 Query: 16 KRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAM 195 K + YS K ++ AR S ++ + + + KR KKK++R N MKL+ + Sbjct: 893 KFVDYSEKAKLRASAQARNSRSPVEVAIEEEKRVAKRKKEQRKKKVRRRKNAAMKLANKL 952 Query: 196 CS 201 S Sbjct: 953 VS 954 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 33 SLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQR 170 +LQ+G S K+++ A+ G+ Q++ ++ E E +DYQR Sbjct: 499 NLQRGYIASNQDKLEWKVFFAMGKTGDNSQDSRNIREAEEQRDYQR 544 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,555,931 Number of Sequences: 59808 Number of extensions: 296142 Number of successful extensions: 952 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -