BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_J04 (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein c... 125 2e-29 At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein c... 39 0.003 At4g35890.1 68417.m05097 La domain-containing protein contains P... 29 3.7 At4g18150.1 68417.m02697 hypothetical protein 29 3.7 At3g05480.1 68416.m00600 cell cycle checkpoint control protein f... 29 3.7 At2g43000.1 68415.m05336 no apical meristem (NAM) family protein... 29 3.7 At1g34060.1 68414.m04222 alliinase family protein contains Pfam ... 28 4.9 At5g52480.1 68418.m06511 leucine-rich repeat protein, N7-related... 28 6.5 At2g20190.1 68415.m02361 CLIP-associating protein (CLASP) -relat... 28 6.5 At2g40113.1 68415.m04932 hypothetical protein 27 8.6 >At3g20390.1 68416.m02583 endoribonuclease L-PSP family protein contains Pfam domain PF01042: Endoribonuclease L-PSP Length = 187 Score = 125 bits (302), Expect = 2e-29 Identities = 62/130 (47%), Positives = 89/130 (68%), Gaps = 1/130 (0%) Frame = +2 Query: 29 TANAHRVVKTIVTSPDVYKPVGPYSQAILSDKTLYISGVLGM-DRDAQLVSGGVGAQTRQ 205 + +A V K +V++ +GPYSQAI ++ +++SGVLG+ + VS V QT Q Sbjct: 56 SVSASSVKKEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQ 115 Query: 206 VLENLKHVVEAGGGSLESVIKTTILLANMDDFQCVNQIYAEYFPKNCPARATYQVTKLPL 385 VL+N+ +++A G SV+KTTI+LA++ DF+ VN+IYA+YFP PAR+TYQV LPL Sbjct: 116 VLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPL 175 Query: 386 NAAVEIEAIA 415 NA +EIE IA Sbjct: 176 NAKIEIECIA 185 >At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein contains Pfam domain PF01902: Domain of unknown function Length = 715 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +2 Query: 89 VGPYSQAILSDKTLYISGVLGMDRDA-QLVSGGVGAQTRQVLENLKHVVEAGGGSLES 259 +GPYSQA L L+++G LG+D L + G A+ Q L N + + E+ S+ S Sbjct: 425 IGPYSQATLHQSVLHMAGQLGLDPPTMNLQTEGAIAELNQALTNSEAIAESFNCSISS 482 >At4g35890.1 68417.m05097 La domain-containing protein contains Pfam PF05383: La domain Length = 523 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -3 Query: 450 GPASVMTRSPLRAIASISTAAFRGSLVT 367 GP+S +R+P+ IAS+S AA +++T Sbjct: 64 GPSSPQSRAPIEPIASVSVAAPTAAVLT 91 >At4g18150.1 68417.m02697 hypothetical protein Length = 762 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +2 Query: 176 SGGVGAQTRQVLENLKHVVEAGGGSLESVIKTTILLANMDDFQCVNQIYAE 328 +GGV A +R+V+++LK +VE E I ++ +M+ + VN++ ++ Sbjct: 12 NGGVPASSRKVIQDLKEIVECS----ELEIYAMLVECDMNPDEAVNRLLSQ 58 >At3g05480.1 68416.m00600 cell cycle checkpoint control protein family contains Pfam profile PF04139: Rad9; contains Prosite PS00976: Myristoyl-CoA:protein N-myristoyltransferase signature 2; similar to radio-resistance/chemo-resistance/cell cycle checkpoint control protein (GI:3869274) [Mus musculus] Length = 439 Score = 28.7 bits (61), Expect = 3.7 Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 10/67 (14%) Frame = -1 Query: 236 PQLHASSFLKLGASVL--PLHQIP-----TAHHDPCRV---LPIYRESCQIKWLDCRVQP 87 PQ H S LK SVL PL I HD +V L Y + W+ C V+P Sbjct: 66 PQAHFSVLLKAVCSVLRTPLASIDHMSVQLPDHDASKVKWTLQCYSGMKKTYWITCNVEP 125 Query: 86 VYRHLGM 66 +HL + Sbjct: 126 DIQHLSL 132 >At2g43000.1 68415.m05336 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; Length = 275 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 5 SKMSSTDSTANAHRVVKTIVTSPDVYKPVGPY 100 SK SS DS +HR V ++ P + +P PY Sbjct: 192 SKTSSLDSDHTSHRTVDSMSHEPPLPQPQNPY 223 >At1g34060.1 68414.m04222 alliinase family protein contains Pfam profiles: PF04864 allinase C-terminal domain, PF04863 alliinase EGF-like domain Length = 463 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 98 YSQAILSDKTLYISGVLGMDRDAQLVSGGVGAQTR-QVLENLKHVVEAGGGSLES 259 + ++ DK +Y MDR +L S GV +T+ VL+ LK VV GG + S Sbjct: 294 FGWGLVKDKAIYEK----MDRFIRLTSMGVSKETQLHVLQLLKVVVGDGGNEIFS 344 >At5g52480.1 68418.m06511 leucine-rich repeat protein, N7-related contains PF00560: Leucine Rich Repeat; similar to F-box protein Fbl2 (GI:6164721) [Homo sapiens] Length = 241 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 368 VTKLPLNAAVEIEAIALSGDLVITEAGPCPCART*YINIL 487 V KLP+ +E+ I+LSG+ + CP +T +N L Sbjct: 73 VVKLPMLEELEVSGISLSGESMKLAGLSCPNLKTLMLNRL 112 >At2g20190.1 68415.m02361 CLIP-associating protein (CLASP) -related similar to CLIP-associating protein CLASP2 (GI:13508651) [Rattus norvegicus] Length = 1439 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 137 SGVLGMDRDAQLVSGGVGAQTRQVLENLKHVVEAGGGSLESVIKTT 274 S ++ MDR + L SGG + +L K V + SLESV++++ Sbjct: 540 SAIVAMDRSSNLSSGG-SLSSGLLLSQSKDVNKGSERSLESVLQSS 584 >At2g40113.1 68415.m04932 hypothetical protein Length = 144 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 248 IHLPPQLHASSFLKLGASVLPLHQIPTAHH 159 IHLP LHA L+ V P+H +P +H Sbjct: 66 IHLPSHLHAIPQLEKACFVKPIH-VPKHYH 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,489,186 Number of Sequences: 28952 Number of extensions: 309535 Number of successful extensions: 764 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -