BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_M07 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 28 4.0 SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 5.3 SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) 27 7.0 SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_50529| Best HMM Match : 7TMR-HDED (HMM E-Value=2.3) 27 9.2 SB_22524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_11307| Best HMM Match : Pam16 (HMM E-Value=5.4) 27 9.2 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.1 bits (67), Expect = 0.43 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +1 Query: 70 EDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLSALGSVDLTNQMKLGAA 249 +++P V+ + T+N + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 250 TAGLAY-DNVNGHGATLT-KTHIPGFGDKMTAAGKVN 354 ++Y DN+N A T + IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +2 Query: 11 SASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL*LETKI 190 SA+TA S+ + TL +S ++GPTP + ++ L+ + + L + + + Sbjct: 113 SATTAQDSSVLDTLATLATATLSHNTGPTPSTSMQQATSLAGRISVTPLTLSQNTISSSL 172 Query: 191 TG-SVPLAP 214 +G S PL P Sbjct: 173 SGLSTPLTP 181 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 29 TCSLKSLVTTLNNMRISRSSGPTPGC 106 T + K+++TTL MRI ++GP C Sbjct: 654 TTTKKTIITTLTTMRICAANGPLIDC 679 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 27.9 bits (59), Expect = 4.0 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 2/90 (2%) Frame = +1 Query: 151 GAMVKVPITGNENHRLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDK 330 G V +T E +L ALG +T+ + T L++ N + A+ K+ I G Sbjct: 401 GIYVGGAVTAMEEDQLVALG---VTHVLNAAQGTKRLSHVNTD---ASFYKSGIIFHGIP 454 Query: 331 MTAAG--KVNLFHNDNHDFSAKAFATKNLP 414 T K+N + ++ DF A A TKN P Sbjct: 455 ATDVFMFKLNKYFDEAADFIASAVGTKNCP 484 >SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 102 GAPASGCTNCQLRRHLRCYGQGTYNWKRKS 191 G PA N QL R RC TY W RKS Sbjct: 73 GKPAYFAKNLQLDRK-RCLYPKTYTWDRKS 101 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.5 bits (58), Expect = 5.3 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +1 Query: 22 SRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLS 201 +R + EP ++ EDQ E A+S +R +AG +D G + + T N NH Sbjct: 1183 ARKAQINEPPSPLKVQEDQRETEAHSPIRTRAGREATCNDHLKGCVNQA--TCN-NHLKG 1239 Query: 202 ALGSVDLTNQMKLGAATAGLAYDNVNG 282 + + +K G D++ G Sbjct: 1240 CVNQATCNDHLK-GCVNQATCNDHLKG 1265 >SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) Length = 1592 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 123 TNCQLRRHL-RCYGQGTYNWKRKSQAQCPWLRRS 221 TN Q L R Y YNW+ + + PWL ++ Sbjct: 1207 TNIQTNVSLVRKYNSWEYNWRNSLEKRMPWLGKT 1240 >SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +1 Query: 223 TNQMKLGAATAGLAYDNVNGHGAT--LTKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKA 393 TNQ L Y+ +N A L + +P G+K +G+ N+ D DFS A Sbjct: 59 TNQTLLHVVVLDTQYERMNSTYACALLANSRLPCVGEKDCESGEGNISSIDMKDFSNAA 117 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 34 LVEEPGYYIEQYEDQPEQW 90 L EEPGYYIE + PE W Sbjct: 210 LDEEPGYYIE--KKAPESW 226 >SB_50529| Best HMM Match : 7TMR-HDED (HMM E-Value=2.3) Length = 697 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 5 FWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 172 FW +S+ + S S+ +L+++R S G + LS T P W+RY+ Sbjct: 262 FWFSSSRFSRSSSSISDSLSSLRSRASWRRLSDVLGSSMVSLSGATTPCSSWTRYV 317 >SB_22524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +1 Query: 319 FGDKMTAAG---KVNLFHNDNHDFSAKAF 396 F ++ T++G KV LFH N+ F+AK+F Sbjct: 35 FAEQDTSSGLTTKVCLFHGKNNPFTAKSF 63 >SB_11307| Best HMM Match : Pam16 (HMM E-Value=5.4) Length = 405 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 5 FWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 172 FW +S+ + S S+ +L+++R S G + LS T P W+RY+ Sbjct: 69 FWFSSSRFSRSSSSISDSLSSLRSRASWRRLSDVLGSSMVSLSGATTPCSSWTRYV 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.131 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,594,168 Number of Sequences: 59808 Number of extensions: 296146 Number of successful extensions: 608 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -