BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L24 (383 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 37 0.006 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.020 SB_19226| Best HMM Match : I-set (HMM E-Value=0) 35 0.020 SB_37927| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.026 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 33 0.080 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 32 0.14 SB_8818| Best HMM Match : I-set (HMM E-Value=0) 32 0.18 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.24 SB_47305| Best HMM Match : I-set (HMM E-Value=0) 31 0.32 SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33) 31 0.43 SB_42488| Best HMM Match : ig (HMM E-Value=4.2e-06) 30 0.56 SB_29237| Best HMM Match : I-set (HMM E-Value=0) 30 0.56 SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) 29 0.98 SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) 29 0.98 SB_42490| Best HMM Match : V-set (HMM E-Value=0.00058) 29 0.98 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 29 1.3 SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_8819| Best HMM Match : I-set (HMM E-Value=0) 29 1.7 SB_5575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_55898| Best HMM Match : Carb_anhydrase (HMM E-Value=3.6) 28 2.3 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 2.3 SB_25692| Best HMM Match : I-set (HMM E-Value=2e-20) 28 2.3 SB_10606| Best HMM Match : I-set (HMM E-Value=0) 28 2.3 SB_42489| Best HMM Match : ig (HMM E-Value=6.9e-06) 28 3.0 SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) 28 3.0 SB_23359| Best HMM Match : I-set (HMM E-Value=0) 28 3.0 SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_57926| Best HMM Match : I-set (HMM E-Value=3.5e-39) 28 3.0 SB_31893| Best HMM Match : I-set (HMM E-Value=2e-22) 28 3.0 SB_58153| Best HMM Match : RepA_C (HMM E-Value=7.7) 27 4.0 SB_43939| Best HMM Match : I-set (HMM E-Value=1.3e-14) 27 5.2 SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) 27 5.2 SB_30375| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_28793| Best HMM Match : Furin-like (HMM E-Value=2.6) 27 5.2 SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_53869| Best HMM Match : ABC_membrane (HMM E-Value=0.34) 27 6.9 SB_17270| Best HMM Match : ABC_tran (HMM E-Value=5.1e-08) 27 6.9 SB_10327| Best HMM Match : Trypsin (HMM E-Value=0) 27 6.9 SB_29364| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_23464| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) 26 9.2 SB_52866| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 26 9.2 >SB_29852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 36.7 bits (81), Expect = 0.006 Identities = 20/74 (27%), Positives = 33/74 (44%) Frame = +3 Query: 72 LDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKY 251 L C P++YP I W K+ + T +G+L+F + + D D Y Sbjct: 160 LHCQAPDSYPDRQIQWSKQDPNFPGRRRPLPQSSKYTISSEGDLHFAYLEQSDSGD---Y 216 Query: 252 VCTAKNAAVDEEVV 293 VCT N ++++ V Sbjct: 217 VCTVTNNNINKQQV 230 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 36.7 bits (81), Expect = 0.006 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 3/96 (3%) Frame = +3 Query: 39 EKTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIV 218 +K EG+PF+LD V+ A P+ + W K P D +R G+ YF I+ Sbjct: 2041 DKEVKEGKPFKLD-VKITALPEANVKWLKDGEPLKPG-DHFKTERH------GDTYFLII 2092 Query: 219 TKEDVSDIYKYVCTAKN---AAVDEEVVLVEYEIKG 317 + DV D +Y C A N A E +LVE +G Sbjct: 2093 PEADVEDEGRYRCEAVNNAGRASTEADILVESADEG 2128 Score = 29.9 bits (64), Expect = 0.74 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 PKP + W K P + + RR G G +Y ++ + SD KY+C A N+A Sbjct: 2227 PKPEVDWFK---DGKPVSGLPH--RRFEVGCVGEVYTLVIKEARGSDTGKYLCKAYNSA 2280 Score = 29.1 bits (62), Expect = 1.3 Identities = 26/93 (27%), Positives = 39/93 (41%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAAV 278 PKP +TW K + +T+ D I + Y I+ D Y CTA N +V Sbjct: 4528 PKPTVTWTK------DSKPITETD-HIQVSVYDDTYTLIIKSPTDKDEGIYKCTASN-SV 4579 Query: 279 DEEVVLVEYEIKGVTKDNSGYKGEPVPQYVSKD 377 + + +IKG T K + P +V +D Sbjct: 4580 GTSSQMFDVDIKG-TDWMLKSKDDDFPSFVDED 4611 Score = 27.9 bits (59), Expect = 3.0 Identities = 19/76 (25%), Positives = 34/76 (44%) Frame = +3 Query: 42 KTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVT 221 K +EG L+ V+ + PKP++ W K P++ +T +G ++ + Sbjct: 2973 KEVVEGSRTDLE-VEVSGKPKPVVEWLKDGELVKPSS-------LMTLETEGQVHTLTIM 3024 Query: 222 KEDVSDIYKYVCTAKN 269 + D +Y C AKN Sbjct: 3025 NTTLDDEGEYTCIAKN 3040 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 168 DRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 D I D +LY ++ + + D KY C KN A Sbjct: 4010 DDHIKITSDDDLYTVLIRQPTIKDTGKYKCIIKNIA 4045 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 35.1 bits (77), Expect = 0.020 Identities = 23/81 (28%), Positives = 36/81 (44%) Frame = +3 Query: 27 AKTHEKTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLY 206 A H++ +EG +L+C + A P+P++ WKK D D+ I DG Sbjct: 3435 APLHDQEVVEGETIRLEC-RVRATPRPMVEWKK-----DGRTFKEDY--HIYTEFDGQHC 3486 Query: 207 FTIVTKEDVSDIYKYVCTAKN 269 ++ + D Y C AKN Sbjct: 3487 TLVIKGAQIEDEGAYECIAKN 3507 Score = 31.9 bits (69), Expect = 0.18 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG F+L C + P P I W K PN R+ G G+ YF + + Sbjct: 2860 EGSSFKLRC-RVTGTPTPTIEWYKSNMPLKPNG-------RVIIGHTGDQYFLNFLETEA 2911 Query: 234 SDIYKYVCTAKN 269 D +Y+ AKN Sbjct: 2912 RDEGRYMLVAKN 2923 Score = 30.3 bits (65), Expect = 0.56 Identities = 23/75 (30%), Positives = 36/75 (48%) Frame = +3 Query: 51 IEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKED 230 IEG +++C + + P+P ITW K D +TD RI DG++ + Sbjct: 2563 IEGEAIKMEC-RVSGKPEPTITWLK-----DGLVFLTD--NRIKTYFDGDVCTLTIRDVK 2614 Query: 231 VSDIYKYVCTAKNAA 275 + D Y C AKN++ Sbjct: 2615 LGDEGIYRCNAKNSS 2629 Score = 29.1 bits (62), Expect = 1.3 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = +3 Query: 96 YPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 +P P +TW + PN+ + A +G ++ ++T+ D Y C AKN+A Sbjct: 5154 FPTPDVTWLREDKQITPNSHP-----HMKALHEGEVHSLLITEGGYKDSGVYKCIAKNSA 5208 Query: 276 VDEEVV 293 + V Sbjct: 5209 GQDTTV 5214 Score = 27.5 bits (58), Expect = 4.0 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +3 Query: 93 AYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN 269 A PKP + W K G + ++ R+ GN ++ +T + D Y C A+N Sbjct: 2477 ANPKPQVIWYK--DGKHTSENI-----RLDVRSRGNTHYLKITNAKIEDSGSYKCEARN 2528 >SB_19226| Best HMM Match : I-set (HMM E-Value=0) Length = 1500 Score = 35.1 bits (77), Expect = 0.020 Identities = 27/89 (30%), Positives = 40/89 (44%) Frame = +3 Query: 45 TPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTK 224 T ++G L C + +P P+ITW + + +DRR + +G L V K Sbjct: 766 TGVQGDTISLPC-RAKGFPPPVITWSR-------SGQTIPYDRRQSID-NGTLLIGNVQK 816 Query: 225 EDVSDIYKYVCTAKNAAVDEEVVLVEYEI 311 SD KY CTA N A + + V + I Sbjct: 817 ---SDSGKYTCTAVNTAGERDSVTMTVSI 842 >SB_37927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 34.7 bits (76), Expect = 0.026 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPL-ITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKED 230 EG P L+C PN+YP + ITW + N V IT G L F K D Sbjct: 343 EGAPVSLECDPPNSYPIGVAITWFR-------NYQVVQLGSGITVSSSGTLTFATAKKAD 395 Query: 231 VSDIYKYVCTAKNA 272 + Y C+ N+ Sbjct: 396 EGE---YFCSVVNS 406 Score = 27.9 bits (59), Expect = 3.0 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = +3 Query: 51 IEGRPFQLDCVQPNAYPKPL-ITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKE 227 + G+ L+C ++ P+ I WKK G+D D T+ R + +LY+T + + Sbjct: 46 VVGQSLMLNCQATDSTGTPVTINWKK---GSDWLVDPTNKPWRQLR--NNSLYYTSIAAQ 100 Query: 228 DVSDIYKYVCTAKNAAVDEEVVLVE 302 DV + + +A + V VE Sbjct: 101 DVGEFLCGAVSGGSAIIYSRTVTVE 125 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 33.1 bits (72), Expect = 0.080 Identities = 24/72 (33%), Positives = 31/72 (43%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 E +P +L+C P+P ITW K DV D RIT DG +T + Sbjct: 1175 ETQPVRLEC-SVTGTPEPQITWLK-------GGDVVKEDDRITTVFDGETCVLNITVSCL 1226 Query: 234 SDIYKYVCTAKN 269 D +Y C A N Sbjct: 1227 DDEGEYKCLAMN 1238 Score = 28.7 bits (61), Expect = 1.7 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 8/110 (7%) Frame = +3 Query: 51 IEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKED 230 +EG +L+CV P + W K + + + D RI DG+ + I+ + Sbjct: 2121 LEGDSVRLECVISGG-PDAQVLWYK-------DDYLLEEDERIMYDTDGDQHTLIIQSAE 2172 Query: 231 VSDIYKYVCTAKNAA--VDEEVVLVEYE------IKGVTKDNSGYKGEPV 356 + D +Y C N A VD + L+ E IK KD +G+ V Sbjct: 2173 LDDEAEYKCVVTNIAGSVDVKTELIVEEGISLPVIKEGLKDTEANEGDVV 2222 Score = 28.3 bits (60), Expect = 2.3 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 8/110 (7%) Frame = +3 Query: 51 IEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKED 230 +EG +L+CV P + W K + + + D R++ DG+ + I+ + Sbjct: 1703 LEGDSARLECVISGG-PDAHVFWYK-------DDYLLEEDERVSYETDGDQHTLIIQSAE 1754 Query: 231 VSDIYKYVCTAKNAA--VDEEVVLVEYE------IKGVTKDNSGYKGEPV 356 + D +Y C N A VD + L+ E IK KD +GE V Sbjct: 1755 LDDEAEYKCVVTNIAGSVDVKTELIVEEGISLPVIKEGLKDTEANEGEIV 1804 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +3 Query: 168 DRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN----AAVDEEVVLVEYE 308 D R+T D ++K DV D Y CT +N + EV++ E E Sbjct: 1937 DNRVTIKTDETSSTLAISKSDVDDEGLYTCTVRNKMGDTSTSAEVIVEELE 1987 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 32.3 bits (70), Expect = 0.14 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNA 272 P+P ITW ++ S F + P G+LY +TKED YVC A N+ Sbjct: 664 PRPTITWYRKGSKT--------FPKHFKVRPSGSLYIREITKEDQG---TYVCQADNS 710 Score = 28.7 bits (61), Expect = 1.7 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +3 Query: 60 RPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFD-RRITAGPDGNLYFTIVTKEDVS 236 R QL C +A + +ITW R G+ V D +R + L + K S Sbjct: 553 RTTQLHCAVASANLRTVITWHMRPVGSSVLTPVDTLDPKRFLVLANMTLMIKNLKK---S 609 Query: 237 DIYKYVCTAKN 269 D YVCTA N Sbjct: 610 DEAAYVCTANN 620 >SB_8818| Best HMM Match : I-set (HMM E-Value=0) Length = 2787 Score = 31.9 bits (69), Expect = 0.18 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +3 Query: 90 NAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN 269 N +P P + W K D + + I P GN+Y+ I+ K ++D Y C AKN Sbjct: 1860 NGFPTPDVMWYKD----DKELQESQLVKII---PKGNMYYLIIYKASLNDSGIYRCVAKN 1912 Score = 26.6 bits (56), Expect = 6.9 Identities = 28/106 (26%), Positives = 41/106 (38%), Gaps = 8/106 (7%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG L C + +A KP W + N D R+ A DG + Sbjct: 1945 EGNEVSLVC-KLSAEAKPTFEWSR-------NGSPVRLDNRVQASFDGRYSTLKFLNAKI 1996 Query: 234 SDIYKYVCTAKN---AAVDEEVVLVEYEIK-----GVTKDNSGYKG 347 D Y C AKN +A + +LV+ + G+ +D GY+G Sbjct: 1997 EDQGTYSCLAKNVFGSASSQAKLLVKKKGNRPQPIGMIRDIEGYEG 2042 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 31.5 bits (68), Expect = 0.24 Identities = 22/67 (32%), Positives = 26/67 (38%) Frame = +3 Query: 72 LDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKY 251 L C P P P +TW K P+ RI GNL +I K D+ Y Sbjct: 912 LKCNPPKGRPAPTVTWLKNTKAYVPDG------VRIQKVSPGNLVISIAQKADMG---TY 962 Query: 252 VCTAKNA 272 C A NA Sbjct: 963 QCVAANA 969 >SB_47305| Best HMM Match : I-set (HMM E-Value=0) Length = 5832 Score = 31.1 bits (67), Expect = 0.32 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 3/88 (3%) Frame = +3 Query: 15 IASPAKTHEKTPIE---GRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITA 185 IA K E+ PIE G LD + PKP + W K P D + T Sbjct: 86 IAPQIKEKEQEPIEVFEGESVNLD-LTITGKPKPEVVWYK---DGKPLRKTKSIDLKST- 140 Query: 186 GPDGNLYFTIVTKEDVSDIYKYVCTAKN 269 + YF + K +D KY C AKN Sbjct: 141 ---DDSYFLSIPKATPNDSGKYKCEAKN 165 Score = 30.7 bits (66), Expect = 0.43 Identities = 33/112 (29%), Positives = 49/112 (43%), Gaps = 7/112 (6%) Frame = +3 Query: 21 SPAKTHEKTPI---EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGP 191 +P+ T PI EG C + +A P+P +TW + + N V D R T Sbjct: 1902 APSFTTTLKPIDVTEGENHTFIC-RVHARPEPSVTWYR-----NKNEIVPDGRSRTTF-- 1953 Query: 192 DGNLYFTIVTKEDVSDIYKYVCTAKN----AAVDEEVVLVEYEIKGVTKDNS 335 DG Y I+ + D +Y C A N A E+ + + E+K V K+ S Sbjct: 1954 DGETYKLILQDIKIKDAGQYECIASNPIGKAFCTAEMTVNKREVKPVIKEVS 2005 Score = 28.7 bits (61), Expect = 1.7 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN-AA 275 PKP +TW K + + D DR + G+ Y+ + + D Y C A+N Sbjct: 1242 PKPSVTWYK------DDVVIGDEDRNVDIYSRGSSYYFTIKQARPEDKGTYKCEARNDVG 1295 Query: 276 VDEEVVLVEYEIK 314 E ++ E+K Sbjct: 1296 TAFETFPIDVEVK 1308 Score = 28.7 bits (61), Expect = 1.7 Identities = 22/73 (30%), Positives = 30/73 (41%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAAV 278 PKP + W K D TD D + G N+YF + V D Y C A N Sbjct: 4678 PKPEVAWYK-----DDEDVATDADG-LDVGSRDNVYFLRFARPSVKDGGLYKCVATNEH- 4730 Query: 279 DEEVVLVEYEIKG 317 E +L +++G Sbjct: 4731 GEASMLFNLDVEG 4743 Score = 28.3 bits (60), Expect = 2.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 168 DRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNA 272 DR+I G LY+ + K + D Y+C A N+ Sbjct: 2139 DRKIDLKTIGGLYYLEIRKATLDDAGTYICKATNS 2173 Score = 27.9 bits (59), Expect = 3.0 Identities = 21/72 (29%), Positives = 29/72 (40%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG FQL C P+P + W + P+ RR A DGN+ V + ++ Sbjct: 1034 EGDDFQLSC-NVTGRPQPEVQWFRDEVLIKPS-------RRFKASYDGNVSALTVKEAEL 1085 Query: 234 SDIYKYVCTAKN 269 D Y C N Sbjct: 1086 DDDGVYKCVVTN 1097 Score = 27.5 bits (58), Expect = 4.0 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 PKP I W K N + D R+ DG + + + + D Y C A NAA Sbjct: 2962 PKPQIKWTK-------NGKPVESDGRLRTDYDGIVAYLSIWQVSHDDAGTYECIASNAA 3013 Score = 27.1 bits (57), Expect = 5.2 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN 269 P P ITW K + + D RRI GN+Y+ + D Y C A N Sbjct: 2863 PTPHITWYK-------DGEPLDDTRRIDIRSRGNVYYLGILNLKPEDAGTYTCEAGN 2912 Score = 26.2 bits (55), Expect = 9.2 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG + C + YP+P I W + G +D R+T DG + + Sbjct: 5262 EGDVVKFSC-KVTGYPEPEIEWTR--DGVSMESD-----ERVTTWYDGEHSTLSIHNANH 5313 Query: 234 SDIYKYVCTAKN 269 +D Y CT KN Sbjct: 5314 ADSGMYKCTLKN 5325 >SB_12096| Best HMM Match : ig (HMM E-Value=9.4e-33) Length = 942 Score = 30.7 bits (66), Expect = 0.43 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +3 Query: 39 EKTPIEGRPFQLDCVQPNA-YPK--PLITWKKRLSGADPNADVTDFDRRITAGPDGNLYF 209 EK G+PF L C + N YP+ W + S + ++ I +GNL F Sbjct: 445 EKQVTVGQPFMLKCPERNTKYPQFGASYYWGNKDSTTN-TINLLPQSSNIAMTQNGNLVF 503 Query: 210 TIVTKEDVSDIYKYVCTAKNAAV 278 VT+ D+ I + AKN + Sbjct: 504 LYVTEADLKTIDDWGRGAKNGTI 526 >SB_42488| Best HMM Match : ig (HMM E-Value=4.2e-06) Length = 464 Score = 30.3 bits (65), Expect = 0.56 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 12 LIASPAKTHEKTPIEGRPFQLDCVQPNAYPKPLITWK 122 + ++ ++T TP P L C +PN YPKP I WK Sbjct: 248 IFSTSSETITATP--NTPVFLGC-KPNGYPKPTIEWK 281 >SB_29237| Best HMM Match : I-set (HMM E-Value=0) Length = 869 Score = 30.3 bits (65), Expect = 0.56 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +3 Query: 90 NAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKN 269 + YPKP I+W K G D N D R +G+L + ED +Y C A N Sbjct: 611 SGYPKPKISWGKEQQGGD-NLD----KERFIQFENGSLLIKNIKLEDEG---RYYCIAGN 662 Query: 270 AAVDEEVVL 296 A +++ + Sbjct: 663 LADFKQITI 671 >SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1050 Score = 29.5 bits (63), Expect = 0.98 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 279 DEEVVLVEYEIKGVTKDNSGYK 344 D++ ++ Y+++G T DNSGYK Sbjct: 1024 DDDEMIGSYDVEGATFDNSGYK 1045 >SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 868 Score = 29.5 bits (63), Expect = 0.98 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 279 DEEVVLVEYEIKGVTKDNSGYK 344 D++ ++ Y+++G T DNSGYK Sbjct: 842 DDDEMIGSYDVEGATFDNSGYK 863 >SB_42490| Best HMM Match : V-set (HMM E-Value=0.00058) Length = 452 Score = 29.5 bits (63), Expect = 0.98 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 45 TPIEGRPFQLDCVQPNAYPKPLITWK 122 T P L C +PN YPKP I WK Sbjct: 258 TAAPNTPVFLGC-KPNGYPKPTIKWK 282 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 29.1 bits (62), Expect = 1.3 Identities = 34/107 (31%), Positives = 46/107 (42%), Gaps = 5/107 (4%) Frame = +3 Query: 42 KTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVT 221 KT EG+ + +C Q P P +TW K SG+ N T D R + D L T V+ Sbjct: 781 KTTTEGQVVKFEC-QTTGNPSPNVTWLK--SGSAVN---TSVDPRFYSN-DTILMITNVS 833 Query: 222 KEDVSDIYKYVCTAKN--AAVDEEVVL-VEY--EIKGVTKDNSGYKG 347 + D Y C A N + E L V Y E V +D + +G Sbjct: 834 RIDSG---TYSCNASNELGIISAEAALDVRYGPEFVNVPQDKTPNEG 877 Score = 28.7 bits (61), Expect = 1.7 Identities = 22/74 (29%), Positives = 33/74 (44%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG L C Q PK +TW S D ++D + G + + F +++ + Sbjct: 1432 EGSSVNLTC-QLECKPKCSVTWLIGGSLLDTSSDRISVTQPENDGNETS--FLMISNLNR 1488 Query: 234 SDIYKYVCTAKNAA 275 +D Y C AKNAA Sbjct: 1489 TDEASYTCRAKNAA 1502 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 12 LIASPAKTHEKTPIEGRPFQLDCVQPNAYPKPLITWKK 125 LIA+P T EG P + C Q N P+P +TW K Sbjct: 188 LIATPPLYLNVT--EGEPVNITC-QSNDLPRPTVTWYK 222 >SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 28.7 bits (61), Expect = 1.7 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +3 Query: 96 YPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 +PKP++TW + N DV + R+ P+ N ++ SD +Y+C+A N Sbjct: 990 FPKPVVTWTRN------NQDVRS-NARLFVDPNTN--DLLINNILTSDTGQYICSAVNPI 1040 Query: 276 VDEE 287 ++E Sbjct: 1041 GEDE 1044 >SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1496 Score = 28.7 bits (61), Expect = 1.7 Identities = 23/94 (24%), Positives = 42/94 (44%) Frame = +3 Query: 51 IEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKED 230 + G L C +P+P++TW++ G+ P + + D T+ NL + Sbjct: 418 LTGSSLVLHC-NATGHPQPVVTWRR---GSQPISGLADHTLIGTSLRILNL--------E 465 Query: 231 VSDIYKYVCTAKNAAVDEEVVLVEYEIKGVTKDN 332 +D+ +Y CTA N + E +K ++K N Sbjct: 466 PADMEEYTCTASNVG-GKAAASTELTVKALSKPN 498 Score = 28.7 bits (61), Expect = 1.7 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAAV 278 P+P ITW + G+ +T DR + D +L + D + +YVC A N A Sbjct: 645 PEPNITWYRIPEGSQRWQLITPLDRYMHLRSDMSLAIDRTAQVDAA---QYVCVATNIAG 701 Query: 279 DEE 287 +E Sbjct: 702 RDE 704 >SB_8819| Best HMM Match : I-set (HMM E-Value=0) Length = 1789 Score = 28.7 bits (61), Expect = 1.7 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 PKP +TW K + V R I GN Y + + D+ Y+C A N A Sbjct: 1548 PKPKVTWYK-------DGKVLRETRNIQLMSIGNTYSVTIIRTTPDDVGTYMCEATNKA 1599 >SB_5575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 28.7 bits (61), Expect = 1.7 Identities = 22/77 (28%), Positives = 32/77 (41%) Frame = +3 Query: 45 TPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTK 224 T +E + C+ +P P+I W K + DP+ +D R D L Sbjct: 151 TIVENSTAVVPCIS-TGFPAPVINWTKIENSMDPSR--MSYDSRALTIKDVRL------- 200 Query: 225 EDVSDIYKYVCTAKNAA 275 SD+ YVC+A N A Sbjct: 201 ---SDVGTYVCSATNVA 214 >SB_55898| Best HMM Match : Carb_anhydrase (HMM E-Value=3.6) Length = 531 Score = 28.3 bits (60), Expect = 2.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 66 FQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRI 179 F+ D Q N P P +T LS A+P+ DVT ++ ++ Sbjct: 184 FKQDAFQSNERPLPDVT----LSAAEPDKDVTQYEEQL 217 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -1 Query: 197 SIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRVSVRLHTVQ 72 S+RP C V +SVR+SS + + +RVSVR+ +V+ Sbjct: 338 SVRP-CIVCPSVYRVSVRVSSVRPCIVCPSVYRVSVRVSSVR 378 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -1 Query: 206 VEVSIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRVSVRLHTVQ 72 + VS C VS +SVR+SS + + +R+SVR+ +V+ Sbjct: 410 IRVSSAHPCLVCPSVSRLSVRVSSVRPCIVCPSVYRLSVRVSSVR 454 Score = 26.6 bits (56), Expect = 6.9 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 206 VEVSIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRVSVRLHTVQ 72 V VS C V +SVR+SS + + +RVSVR+ +V+ Sbjct: 315 VRVSCVRPCIVCPSVYRLSVRVSSVRPCIVCPSVYRVSVRVSSVR 359 Score = 26.6 bits (56), Expect = 6.9 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -1 Query: 197 SIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRVSVRLHTVQ 72 S+RP C V +SVR+SS + + +R+SVR+ +V+ Sbjct: 433 SVRP-CIVCPSVYRLSVRVSSVRPCIVCPSVYRLSVRVSSVR 473 Score = 26.2 bits (55), Expect = 9.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 Query: 197 SIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRVSVRLHTVQ 72 S+RP C V +SVR+SS + + +R+SVR+ V+ Sbjct: 357 SVRP-CIVCPSVYRVSVRVSSVRPCIVCPSVYRLSVRVSCVR 397 >SB_25692| Best HMM Match : I-set (HMM E-Value=2e-20) Length = 104 Score = 28.3 bits (60), Expect = 2.3 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNA 272 P P ITW + N D +G+L I+ K SDI +Y CTA+NA Sbjct: 42 PAPTITWSRNGQEMPANGD------GYLVTNNGSL---ILEKVSSSDIGRYTCTARNA 90 >SB_10606| Best HMM Match : I-set (HMM E-Value=0) Length = 872 Score = 28.3 bits (60), Expect = 2.3 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNA 272 P P ITW + N D +G+L I+ K SDI +Y CTA+NA Sbjct: 700 PAPTITWSRNGQEMPANGD------GYLVTNNGSL---ILEKVSSSDIGRYTCTARNA 748 Score = 27.9 bits (59), Expect = 3.0 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = +3 Query: 99 PKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAAV 278 PKPL+ W K + DR ++ G+L ++ SD +YVCTA+N Sbjct: 258 PKPLVDWSKT------GQPIISGDR-VSVTVTGSL---VIVNSRSSDSGEYVCTARNLLG 307 Query: 279 DEEVV 293 ++ V Sbjct: 308 EDSAV 312 Score = 26.6 bits (56), Expect = 6.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 171 RRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAAVDEEVVLVEYEIK 314 +R+ D N +IV + +D +YVCTA NA +E Y ++ Sbjct: 164 QRVVKDVDENGTLSIVLRR-TTDAGRYVCTAVNAIGSDEAETFVYVVE 210 >SB_42489| Best HMM Match : ig (HMM E-Value=6.9e-06) Length = 369 Score = 27.9 bits (59), Expect = 3.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 72 LDCVQPNAYPKPLITWK 122 L C +PN YPKP I WK Sbjct: 228 LGC-KPNGYPKPTIEWK 243 >SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) Length = 609 Score = 27.9 bits (59), Expect = 3.0 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +3 Query: 147 NADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNAA 275 N D T P G L V+K + D+ +YVC A+NAA Sbjct: 88 NGSAVVLDDLHTINPLGTLQIASVSK--LRDVGEYVCIARNAA 128 >SB_23359| Best HMM Match : I-set (HMM E-Value=0) Length = 367 Score = 27.9 bits (59), Expect = 3.0 Identities = 36/120 (30%), Positives = 49/120 (40%), Gaps = 2/120 (1%) Frame = +3 Query: 21 SPAKTHEKTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGN 200 SP++ H GR +L C YP P I W PN T + G Sbjct: 105 SPSRQHYVAT--GRQVELLCTV-TGYPVPSIEW------IVPNR--TGLSPSLVKVAQGV 153 Query: 201 LYFTIVTKEDVSDIY--KYVCTAKNAAVDEEVVLVEYEIKGVTKDNSGYKGEPVPQYVSK 374 L I E+V+ Y +Y C AKN E V+ + + VT+ N+ +PV Q V K Sbjct: 154 LKIVI---ENVTSPYEGRYRCMAKNNLGTAEEVVQLFVVPNVTRPNN-VSVQPVNQKVVK 209 >SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1744 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 15 IASPAKTHEKTPIEGRPFQLDCVQPNAYPK 104 + +PA+ + P + RP Q D P YP+ Sbjct: 1699 VPAPAEDQDDVPDQDRPTQADVTPPQRYPQ 1728 >SB_57926| Best HMM Match : I-set (HMM E-Value=3.5e-39) Length = 788 Score = 27.9 bits (59), Expect = 3.0 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +3 Query: 57 GRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVS 236 G DC Q P P +TW K S D ++ T F ++ DG L T + D Sbjct: 339 GETVVFDC-QTRGNPTPTVTWWKGSSVIDISSPSTRFHQK----SDGALQITGTQRVDNG 393 Query: 237 DIYKYVCTAKNA 272 Y C A+N+ Sbjct: 394 ---VYTCLARNS 402 >SB_31893| Best HMM Match : I-set (HMM E-Value=2e-22) Length = 767 Score = 27.9 bits (59), Expect = 3.0 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = +3 Query: 12 LIASPAKTHEKTPIEGRPFQ-----LDCVQPNAYPKPLITWKK 125 ++A+ K EK P + FQ L+C + YP+P++TW++ Sbjct: 404 IVATKPKFIEKPPSKVTAFQSTSTKLEC-KVEGYPEPVVTWRR 445 >SB_58153| Best HMM Match : RepA_C (HMM E-Value=7.7) Length = 426 Score = 27.5 bits (58), Expect = 4.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 165 FDRRITAGPDGNLYFTIVTKEDVSDIYKYVCTAKNA 272 FDR I GP+ N F ++ + Y C AK A Sbjct: 49 FDRIIVCGPEANDKFKVMQVSHEKGYWGYECLAKAA 84 >SB_43939| Best HMM Match : I-set (HMM E-Value=1.3e-14) Length = 84 Score = 27.1 bits (57), Expect = 5.2 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +3 Query: 39 EKTPIEGRPFQLDCVQPNAYPKPLITWK---KRLSGADPNADVTDFDRRITAG 188 ++T EG L C P +P P +TW+ RL+ +++D R + G Sbjct: 11 DRTLNEGETLILSCY-PGGFPVPYVTWRFNGTRLAANSSVLEISDVKRAMHHG 62 >SB_32327| Best HMM Match : ig (HMM E-Value=7.9e-23) Length = 932 Score = 27.1 bits (57), Expect = 5.2 Identities = 21/71 (29%), Positives = 29/71 (40%) Frame = +3 Query: 57 GRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVS 236 G+ +L C Q + YP P ITW P T +D G I + + Sbjct: 810 GKAAKLTC-QADGYPLPQITW-----NPSPPMGNTSYD---VIGRTTVRATLIFVPRNAT 860 Query: 237 DIYKYVCTAKN 269 D KY C+A+N Sbjct: 861 DFGKYKCSARN 871 >SB_30375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.1 bits (57), Expect = 5.2 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 21 SPAKTHEKTPIEGRPFQLDCVQPNAYPKPLITWKKRLS 134 +P H K +PF L+ P+ PKPL T K ++ Sbjct: 184 NPQFHHRKPKDILKPFDLEACPPSKLPKPLQTLMKAIT 221 >SB_28793| Best HMM Match : Furin-like (HMM E-Value=2.6) Length = 300 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 246 KYVCTAKNAAVDEEVVLVEYEIKGVTKDNSGYKGEPVPQYVS 371 K T N + + YE+K T KGE +P+Y + Sbjct: 250 KMSTTPDNIPTSSDEIPTTYELKSTTNVKPSPKGEKLPEYTT 291 >SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1226 Score = 26.6 bits (56), Expect = 6.9 Identities = 22/74 (29%), Positives = 28/74 (37%) Frame = +3 Query: 54 EGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDV 233 EG + C AYP P I+W + N V +R P+G L V + D Sbjct: 198 EGTTARFSCKVKKAYPAPSISW-------EHNGQVIVPSKRHVVLPNGALQIHNVQQVDQ 250 Query: 234 SDIYKYVCTAKNAA 275 Y C A N A Sbjct: 251 G---TYQCVASNIA 261 >SB_53869| Best HMM Match : ABC_membrane (HMM E-Value=0.34) Length = 403 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 230 VFFSDDCEVEVSIRPSCDAAIKVSHISVRISSGQTFLPSN 111 + ++DD ++ VSIRPS D + +S + V + + SN Sbjct: 1 MIYADDTQLYVSIRPSEDRSSVLSRLEVCVKDILIWCTSN 40 >SB_17270| Best HMM Match : ABC_tran (HMM E-Value=5.1e-08) Length = 771 Score = 26.6 bits (56), Expect = 6.9 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -1 Query: 269 VLGGAYVFINVTDVFFSDDCEVEVSIRPSCDAAIKVSHISVRISSGQTFLPSNQGFRV 96 V+GG YV N ++ E S R DA ++ H + SS + S +G ++ Sbjct: 425 VIGGVYVKDNFAPSQLFNEWESYQSERDGVDAPVESPHTVIDTSSTANLVASTKGVQL 482 >SB_10327| Best HMM Match : Trypsin (HMM E-Value=0) Length = 865 Score = 26.6 bits (56), Expect = 6.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 1 GRLTSSHRQRRHTRKRQSKAGLSNWTVCSRT 93 GR++SS + + +QSK L N+T C T Sbjct: 418 GRISSSDQHTLADKLQQSKVPLVNYTTCRST 448 >SB_29364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 26.6 bits (56), Expect = 6.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 42 KTPIEGRPFQLDCVQPNAYPKPLI 113 KT PF + C++PN Y KP++ Sbjct: 561 KTLSRCHPFFVRCIKPNDYKKPMM 584 >SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 26.6 bits (56), Expect = 6.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 230 VFFSDDCEVEVSIRPSCDAAIKVSHISVRISSGQTFLPSN 111 + ++DD ++ VSIRPS D + +S + V + + SN Sbjct: 507 MIYADDTQLYVSIRPSEDRSSVLSRLEVCVKDILIWCTSN 546 >SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 18 ASPAKTHEKTPIEGRPFQLDCVQPNAYPKPLITWKKRLSGA 140 +S + +HE + E F + C + +P P +TW +LSG+ Sbjct: 10 SSLSSSHEVS--ENDDFNVTC-SASGHPDPNVTWVNKLSGS 47 >SB_23464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 26.2 bits (55), Expect = 9.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 6 TYLIASPAKTHEKTP-IEGRPFQLDCVQPNAYPKPLITWKKRLSGADPNADVT 161 T+ + A + TP + PF L V + K ++ LS +DPN +VT Sbjct: 162 THYLTPGALDVQLTPGVTSLPFNLTLVDTDDIVKANTEFRVMLSSSDPNVNVT 214 >SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) Length = 405 Score = 26.2 bits (55), Expect = 9.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 249 YVCTAKNAAVDEEVVLVEYEIKGVTKDNSGYKGEPVPQ 362 Y T++ A D++ VL + KG+ KDN +G+ +P+ Sbjct: 238 YASTSRQQA-DKKYVLENWFNKGMAKDNETSEGKRLPR 274 >SB_52866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 26.2 bits (55), Expect = 9.2 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 96 YPKPLITWKKRLSGADPNADVTDFDRRITAGPDGNLYFTIVTKEDVSDIYKYVCT 260 YPKP W K +PN + R + G++ F+ V ++SD Y CT Sbjct: 335 YPKPTFVWTKNGQPWNPN------EGRFSTQDGGSVKFSRV---EISDQGNYTCT 380 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 26.2 bits (55), Expect = 9.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 42 KTPIEGRPFQLDCVQPNAYP 101 +TP EG + LD V P YP Sbjct: 698 ETPFEGGTYNLDIVIPETYP 717 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,325,785 Number of Sequences: 59808 Number of extensions: 209316 Number of successful extensions: 733 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -