BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L18 (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) 29 2.3 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.1 >SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) Length = 1165 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = +2 Query: 20 TNTMEVV----ILYLKAVKAQDRLIQVTTDVMYVVSIRVAVSIMVEALRRLVVARTPAKL 187 TNT+ +V IL+L + L+ +TT + VV + + + L LVV T L Sbjct: 514 TNTLPLVVITTILHLVTITTTLHLVTITTTLPLVVITTILPLVTITTLLPLVVITTILPL 573 Query: 188 IQATTAVML 214 + TT + L Sbjct: 574 VVITTTLPL 582 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 114 ETTYMTSVVTWMSRSCALTAFRYSMTTSMVFVWSTQ 7 E Y+T+ + ++ A+ FRYS V +W+ + Sbjct: 1283 EIKYLTTTKYYDTQGVAVRHFRYSFVAQQVMIWTVE 1318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,531,798 Number of Sequences: 59808 Number of extensions: 270196 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -