BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_L06 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 4.5 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 4.5 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +2 Query: 392 VKKIVQVEIDAKVIEVSKKYLPFLAVGFESEKLELHVGDGFESLKEHSQE 541 +K I++++ D V++KYL + + + + D FE + +H+ + Sbjct: 581 LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFE-ISDHNDD 629 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +2 Query: 392 VKKIVQVEIDAKVIEVSKKYLPFLAVGFESEKLELHVGDGFESLKEHSQE 541 +K I++++ D V++KYL + + + + D FE + +H+ + Sbjct: 581 LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFE-ISDHNDD 629 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +2 Query: 392 VKKIVQVEIDAKVIEVSKKYLPFLAVGFESEKLELHVGDGFESLKEHSQE 541 +K I++++ D V++KYL + + + + D FE + +H+ + Sbjct: 581 LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFE-ISDHNDD 629 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +2 Query: 392 VKKIVQVEIDAKVIEVSKKYLPFLAVGFESEKLELHVGDGFESLKEHSQE 541 +K I++++ D V++KYL + + + + D FE + +H+ + Sbjct: 581 LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFE-ISDHNDD 629 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 365 AREVAKHPKVKKIVQVEIDA 424 A++ AK +K +VQ+ +DA Sbjct: 54 AKDYAKFIHIKAVVQITLDA 73 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 365 AREVAKHPKVKKIVQVEIDA 424 A++ AK +K +VQ+ +DA Sbjct: 54 AKDYAKFIHIKAVVQITLDA 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,442 Number of Sequences: 336 Number of extensions: 3158 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -