BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_M11 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_22485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 >SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 332 YCSESLKCGAFFFDVNPCDDXFMIDALDAAKSFYNQLNNVST 457 +CS+S+K + CD + + +D Y LNN T Sbjct: 97 FCSKSVKSNQMGVQCDSCDKWYHVRCMDMPTEVYQGLNNSCT 138 >SB_22485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 28.7 bits (61), Expect = 3.3 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +2 Query: 107 TIKMILIASVITQIFCAPQEIIRNSSTLRTPANLSYEELEYILSVRNGQVQVKPKTLSPC 286 T+KM L+ I +F P +I+ L N Y L L + + T S Sbjct: 285 TVKMFLLIVTIFLLFMLPNQILW---LLFDFGNSEY--LLAHLDLIAFTCRAFTYTNSVL 339 Query: 287 ARAILGCCNGNVMNSY-CSESLKCG 358 AI G CNG+ N++ C+ KCG Sbjct: 340 NAAIYGACNGSFRNAFACTLKCKCG 364 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,388,792 Number of Sequences: 59808 Number of extensions: 262071 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -