Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP02_T7_P23
         (942 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    48   9e-08

>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 48.4 bits (110), Expect = 9e-08
 Identities = 26/62 (41%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -2

Query: 293 MCAGGEAGKDSCKGDSGGPLMYEH--SKKYEAVGIVSFGPEKCGQIDIPGVYTNVYEYLP 120
           MCA  + GKD+C+ DSGGP+++++  +K+   +GI+S+G E CG+   P   T V  Y+ 
Sbjct: 335 MCAYAK-GKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAE-CGK--YPNGNTKVGSYID 390

Query: 119 WI 114
           WI
Sbjct: 391 WI 392


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,033
Number of Sequences: 438
Number of extensions: 4013
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 30839445
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)