SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP02_T7_F01
         (771 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    26   0.45 
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    26   0.45 
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    23   3.1  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    23   3.1  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    23   3.1  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    23   3.1  
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    23   4.2  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    22   5.5  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    22   5.5  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex det...    22   5.5  
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    22   5.5  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   5.5  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    22   5.5  
DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex det...    22   5.5  
DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex det...    22   5.5  
DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex det...    22   5.5  
DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex det...    22   5.5  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    22   5.5  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   5.5  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    22   5.5  
DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    22   5.5  
DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex det...    22   5.5  
DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex det...    22   5.5  
DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex det...    22   5.5  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    22   5.5  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    22   5.5  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    22   5.5  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    22   5.5  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    22   5.5  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    22   5.5  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    22   5.5  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    22   5.5  
AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex det...    22   5.5  
AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex det...    22   5.5  
AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex det...    22   5.5  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    22   5.5  
AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex det...    22   5.5  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   5.5  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   5.5  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    22   5.5  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    22   5.5  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    22   5.5  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    22   5.5  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    22   5.5  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   5.5  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    22   5.5  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    22   5.5  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    22   5.5  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    22   5.5  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    22   5.5  
AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor p...    22   5.5  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   5.5  

>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 131 NFPSRPMGPWVP 142


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 25.8 bits (54), Expect = 0.45
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 216 NFPSRPLGPLXP 251
           NFPSRP+GP  P
Sbjct: 134 NFPSRPMGPWVP 145


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RPLGP
Sbjct: 133 NFPPRPLGP 141


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RPLGP
Sbjct: 133 NFPPRPLGP 141


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RPLGP
Sbjct: 133 NFPPRPLGP 141


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RPLGP
Sbjct: 133 NFPPRPLGP 141


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +1

Query: 184 RCRNPTQNHFGIF 222
           RC NP  N F IF
Sbjct: 410 RCENPKTNFFSIF 422


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 137 NFPPRPMGP 145


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 137 NFPPRPMGP 145


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 127 NFPPRPMGP 135


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 127 NFPPRPMGP 135


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 127 NFPPRPMGP 135


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 133 NFPPRPMGP 141


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 128 NFPPRPMGP 136


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 128 NFPPRPMGP 136


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 130 NFPPRPMGP 138


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 131 NFPPRPMGP 139


>DQ325094-1|ABD14108.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 123 NFPPRPMGP 131


>DQ325093-1|ABD14107.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 123 NFPPRPMGP 131


>DQ325092-1|ABD14106.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 123 NFPPRPMGP 131


>DQ325091-1|ABD14105.1|  175|Apis mellifera complementary sex
           determiner protein.
          Length = 175

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 123 NFPPRPMGP 131


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 126 NFPPRPMGP 134


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 134 NFPPRPMGP 142


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 134 NFPPRPMGP 142


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 137 NFPPRPMGP 145


>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 127 NFPPRPMGP 135


>DQ325080-1|ABD14094.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 132 NFPPRPMGP 140


>DQ325079-1|ABD14093.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 132 NFPPRPMGP 140


>DQ325078-1|ABD14092.1|  184|Apis mellifera complementary sex
           determiner protein.
          Length = 184

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 132 NFPPRPMGP 140


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 139 NFPPRPMGP 147


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 129 NFPPRPMGP 137


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 10/34 (29%), Positives = 18/34 (52%)
 Frame = -3

Query: 373 RWRN*LHSCLLLAAVSVTRHVNMRLSPFTCSASN 272
           RWRN + + L   ++   R  + +L+P+   A N
Sbjct: 85  RWRNGIPATLTYISLDTNRGGSPKLTPYPNWAQN 118


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 348 NFPPRPMGP 356


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 354 NFPPRPMGP 362


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 345 NFPPRPMGP 353


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 354 NFPPRPMGP 362


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569710-1|AAS86663.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569709-1|AAS86662.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569708-1|AAS86661.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569706-1|AAS86659.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 345 NFPPRPMGP 353


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 367 NFPPRPMGP 375


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 374 NFPPRPMGP 382


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 344 NFPPRPMGP 352


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 355 NFPPRPMGP 363


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 355 NFPPRPMGP 363


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 344 NFPPRPMGP 352


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 356 NFPPRPMGP 364


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 362 NFPPRPMGP 370


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 362 NFPPRPMGP 370


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 362 NFPPRPMGP 370


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 348 NFPPRPMGP 356


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 366 NFPPRPMGP 374


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 216 NFPSRPLGP 242
           NFP RP+GP
Sbjct: 376 NFPPRPMGP 384


>AY263366-1|AAO92605.1|  139|Apis mellifera octopamine receptor
          protein.
          Length = 139

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 23 YKSFICKCF 49
          +KS ICKCF
Sbjct: 73 FKSIICKCF 81


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 23  YKSFICKCF 49
           +KS ICKCF
Sbjct: 521 FKSIICKCF 529


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 219,711
Number of Sequences: 438
Number of extensions: 5318
Number of successful extensions: 82
Number of sequences better than 10.0: 79
Number of HSP's better than 10.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 82
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -