BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_J13 (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 153 1e-37 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 133 1e-31 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 117 1e-26 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 94 1e-19 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.009 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 37 0.021 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 36 0.049 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 33 0.34 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) 32 0.46 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 31 1.1 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 31 1.1 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) 31 1.4 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 31 1.4 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 1.4 SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 30 1.8 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 30 2.4 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 29 3.2 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.2 SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) 29 3.2 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 3.2 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 29 3.2 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 3.9 SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) 29 4.2 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_1024| Best HMM Match : Ank (HMM E-Value=0) 29 4.2 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) 29 4.2 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) 29 4.2 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 29 4.2 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 29 5.6 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_36001| Best HMM Match : CheD (HMM E-Value=3.9) 29 5.6 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 5.6 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 29 5.6 SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) 29 5.6 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 5.6 SB_24424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 29 5.6 SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) 29 5.6 SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) 29 5.6 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 5.6 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 28 7.4 SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) 28 7.4 SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) 28 7.4 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 7.4 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_47339| Best HMM Match : Rubredoxin (HMM E-Value=0.76) 28 7.4 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 28 7.4 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 28 7.4 SB_38303| Best HMM Match : Fz (HMM E-Value=9.8e-07) 28 7.4 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 7.4 SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 9.8 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 28 9.8 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 28 9.8 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 153 bits (372), Expect = 1e-37 Identities = 67/114 (58%), Positives = 91/114 (79%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 KE+IERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+KIS+ DK+ IL Sbjct: 514 KEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAIL 573 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPGCRRSPRRYAGLP 189 DKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK+ +P G+P Sbjct: 574 DKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQQAGGAPPGAGGMP 627 Score = 45.2 bits (102), Expect = 6e-05 Identities = 30/65 (46%), Positives = 35/65 (53%) Frame = -2 Query: 775 DNQPRSTHXKYLRGERAMTXR*QLAR*IRADPDXHRRRVACLKXEVTFDIDANGILNVSA 596 DNQP + GER+MT L R + EVTFDIDANGILNVSA Sbjct: 435 DNQP-GVLIQVFEGERSMTAHNNLLGKFELTGIPPAPR-GVPQIEVTFDIDANGILNVSA 492 Query: 595 IEKST 581 ++KST Sbjct: 493 VDKST 497 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/79 (39%), Positives = 36/79 (45%) Frame = -3 Query: 765 PGVLXPSI*GVSVL*PKDNNLLGKFELTRXPTGAAWRAXXXXXXXXXXXXXXXXXPLSRS 586 PGVL G + NNLLGKFELT P + +S Sbjct: 438 PGVLIQVFEGERSM-TAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKS 496 Query: 585 PPXKENKITITNDEGRLSQ 529 KENKITITND+GRLS+ Sbjct: 497 T-GKENKITITNDKGRLSK 514 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 133 bits (322), Expect = 1e-31 Identities = 58/102 (56%), Positives = 81/102 (79%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 KE+IERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+K+S+ +++ ++ Sbjct: 606 KEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVI 665 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPG 225 +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK+ G Sbjct: 666 SRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQG 707 Score = 44.8 bits (101), Expect = 8e-05 Identities = 27/63 (42%), Positives = 32/63 (50%) Frame = -3 Query: 717 KDNNLLGKFELTRXPTGAAWRAXXXXXXXXXXXXXXXXXPLSRSPPXKENKITITNDEGR 538 KDNNLLGKFEL+ P + +S KENKITITND+GR Sbjct: 545 KDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKST-GKENKITITNDKGR 603 Query: 537 LSQ 529 LS+ Sbjct: 604 LSK 606 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/21 (76%), Positives = 21/21 (100%) Frame = -2 Query: 643 EVTFDIDANGILNVSAIEKST 581 +VTFD+D+NGILNVSA++KST Sbjct: 569 DVTFDVDSNGILNVSAVDKST 589 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 117 bits (281), Expect = 1e-26 Identities = 49/102 (48%), Positives = 76/102 (74%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 KEEI+RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ K+S SDK T+ Sbjct: 513 KEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVK 572 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXPG 225 +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K+ G Sbjct: 573 NKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVHGG 614 Score = 42.7 bits (96), Expect = 3e-04 Identities = 30/65 (46%), Positives = 34/65 (52%) Frame = -2 Query: 775 DNQPRSTHXKYLRGERAMTXR*QLAR*IRADPDXHRRRVACLKXEVTFDIDANGILNVSA 596 DNQP T + GER +T L R + EVTFDIDANGILNVSA Sbjct: 434 DNQPAVT-IRVFEGERPLTKHNNLLGKFDLSGIPPAPR-GVPQIEVTFDIDANGILNVSA 491 Query: 595 IEKST 581 +KST Sbjct: 492 KDKST 496 Score = 32.7 bits (71), Expect = 0.34 Identities = 22/63 (34%), Positives = 27/63 (42%) Frame = -3 Query: 717 KDNNLLGKFELTRXPTGAAWRAXXXXXXXXXXXXXXXXXPLSRSPPXKENKITITNDEGR 538 K NNLLGKF+L+ P +S K ITITND+GR Sbjct: 452 KHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKST-GKTGSITITNDKGR 510 Query: 537 LSQ 529 LS+ Sbjct: 511 LSK 513 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 94.3 bits (224), Expect = 1e-19 Identities = 42/94 (44%), Positives = 68/94 (72%), Gaps = 1/94 (1%) Frame = -1 Query: 527 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTIL 351 E+IERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D EKL K+S+ DK+TI Sbjct: 1208 EDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTIT 1267 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNP 249 + I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1268 EAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 643 EVTFDIDANGILNVSAIEKSTXQGEQ 566 EVTF+ID NGIL VSA +K T E+ Sbjct: 1170 EVTFEIDVNGILRVSAEDKGTGNKEK 1195 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 717 KDNNLLGKFELTRXPTGAAWRAXXXXXXXXXXXXXXXXXPLSRSPPXKENKITITNDEGR 538 KDN+ LGKF+L P + KE KITITND+ R Sbjct: 1146 KDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKE-KITITNDQNR 1204 Query: 537 LS 532 L+ Sbjct: 1205 LT 1206 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = -1 Query: 503 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS-DSDKQTILDKCNDTIK 327 EA K R DD + +AKNALES+ F ++ M E L EK+S +++++TI + Sbjct: 704 EAPKAR--DDAKAANERAKNALESHIFGVRDEMNSE-LGEKLSTEAERETISEALTAASD 760 Query: 326 WLDSN 312 WLD + Sbjct: 761 WLDED 765 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 643 EVTFDIDANGILNVSAIEKSTXQGEQ 566 EVTFDIDANGI+NVSA +K T + +Q Sbjct: 281 EVTFDIDANGIVNVSARDKGTGREQQ 306 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 3/98 (3%) Frame = -1 Query: 518 ERMVNEAEKYRNEDD-KQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQTILDK 345 ER A +Y D + + +A+ L++ S K T+ D +K + + D+ + Sbjct: 712 ERAREAATRYNKVDCIEYLDKAEAQFELKALITSTKETIADPDKHMGRFTKDDRVSGNRY 771 Query: 344 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 234 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 36.7 bits (81), Expect = 0.021 Identities = 23/91 (25%), Positives = 45/91 (49%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 164 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGI 258 +K + + + L D+ + E +Q EG+ Sbjct: 165 EKVKN--EGEEERMLHDQRQKEEEQWRKEGV 193 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 35.5 bits (78), Expect = 0.049 Identities = 24/107 (22%), Positives = 48/107 (44%) Frame = -1 Query: 590 EVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 411 E + T T K K+E E E ++ + + +K++E + + + ++ Sbjct: 6 ETEKEGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKEA 65 Query: 410 TMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 E E KEK ++K+ K +T K ++ + A+ E+ E +KE Sbjct: 66 ETEKEAEKEKKKKTEKEEEKGKQEETGKEAETEKQAETEKQEETEKE 112 Score = 29.1 bits (62), Expect = 4.2 Identities = 22/80 (27%), Positives = 38/80 (47%) Frame = -1 Query: 503 EAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKW 324 E EK E +K+ ET + + + E +K EK + KQ +K +T K Sbjct: 6 ETEK-EGETEKEGETEKEAETKKEAETEKEEEKETKKKTEKEEEKWKQEETEKEAETEKE 64 Query: 323 LDSNQLADKEEYEHKQKELE 264 ++ + A+KE+ + +KE E Sbjct: 65 AETEKEAEKEKKKKTEKEEE 84 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 34.7 bits (76), Expect = 0.085 Identities = 24/94 (25%), Positives = 52/94 (55%), Gaps = 1/94 (1%) Frame = -1 Query: 542 VVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSM-KSTMEDEKLKEKISDSD 366 V KE+++ ++EA +D + ++A + ++ S+ + E E +KE + +++ Sbjct: 1032 VYQSKEKLQHRLDEA--LCKQDQYKNSLVEAVDEAKTLKESLYRMVNEHETMKESLLNAN 1089 Query: 365 KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 ++ KC +T K LD+++ D+E+ E Q+E E Sbjct: 1090 REIGRLKCENTAKNLDADRKEDQED-EEVQREGE 1122 Score = 34.7 bits (76), Expect = 0.085 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = -1 Query: 548 TKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISD 372 T++V EE + E + + +++ E I +KN+ L + S +E+ +E +SD Sbjct: 1934 TEMVKKNEEKNNEIEEMREKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSD 1993 Query: 371 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 SD L K + + L+ KEE E +E Sbjct: 1994 SDPNVKLQKLREKFENLEKQVNNVKEEAEKNVQE 2027 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 4/92 (4%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNE--DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 357 KE+++ +VN + +E D+K K + K L+ + + K + +DS K+ Sbjct: 1635 KEKVD-LVNSLHEKMSEMNDEKDKLDDENKQLLDEKSREVTDLKGEVKKAQDDADSVKRL 1693 Query: 356 I--LDKCNDTIKWLDSNQLADKEEYEHKQKEL 267 + + + NDT+K + + LA +E+ EH EL Sbjct: 1694 VDAIIEENDTLKQSEHDLLAIQEDLEHTIDEL 1725 Score = 30.3 bits (65), Expect = 1.8 Identities = 25/87 (28%), Positives = 44/87 (50%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 KEE E +V + + RN+ K+ E ++++ L K M+DE K + ++ +L Sbjct: 2543 KEEAEGLVEKLKVQRNQMIKEIEELKSEKGL----LEQKQQMQDEAQKLR----NEIEVL 2594 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKE 270 K + I D+NQ ++KE K K+ Sbjct: 2595 KKLH-AIALEDANQKSEKELRREKMKK 2620 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 33.1 bits (72), Expect = 0.26 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 8/112 (7%) Frame = -1 Query: 575 RRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQ--KETIQAK---NALESYCFSMKS 411 ++ PLP TK +EE +E E E+ ++ K+ ++AK + +S C S + Sbjct: 630 KKIEEPLPRTKKPEKEEEESEEESEEESEEEEETEKVNKDALKAKATEKSNDSLCLSEEE 689 Query: 410 TMEDEKLKEKISDSD---KQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 + E+E +E D + K + K T + + DK++ E E E Sbjct: 690 SEEEESEEESEEDEEEGAKPSASAKIAKTSETENKVPKVDKDDEEDDDDEEE 741 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 33.1 bits (72), Expect = 0.26 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = -1 Query: 521 IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD-K 345 ++ +VNE +K + + D QK+ I+ + ES + ME EKLKE DK + L+ Sbjct: 1187 LKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKLKE---SKDKISKLEGT 1239 Query: 344 CNDTIKWLDSNQLADKEEYEHKQKEL 267 ND K L+ L+ KE E K +E+ Sbjct: 1240 LNDKAKALEKAHLSLKEA-ETKLEEM 1264 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 32.7 bits (71), Expect = 0.34 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 1/88 (1%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K++ ER E ++ + + +K+K+ + K +E + + E+L+EK + +KQ Sbjct: 914 KDKREREEKERKRRQQQLEKEKKEKEKKLLIEKE--KREKEKQKERLREK-EEKEKQKEA 970 Query: 350 DKC-NDTIKWLDSNQLADKEEYEHKQKE 270 ++ + + L ++L +KEE + K KE Sbjct: 971 ERAKKEKERLLQEDKLHEKEEKDRKDKE 998 Score = 29.9 bits (64), Expect = 2.4 Identities = 39/128 (30%), Positives = 57/128 (44%), Gaps = 16/128 (12%) Frame = -1 Query: 599 RYREVHQXRRTRSPLPTTKVVSPKE---EIERMVNEAEKYR----NEDDKQKETIQAKNA 441 R RE + +R + L K K+ E E+ E +K R E +KQKE +AK Sbjct: 917 REREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKE 976 Query: 440 LESYCFSMK---STMEDEKLKEKIS------DSDKQTILDKCNDTIKWLDSNQLADKEEY 288 E K +D K KEK + DKQ +K D++K + + +DKE Sbjct: 977 KERLLQEDKLHEKEEKDRKDKEKRKVEKEKREKDKQVEKEK-KDSLKRVKKRKDSDKER- 1034 Query: 287 EHKQKELE 264 + K+KE E Sbjct: 1035 KVKEKEEE 1042 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 32.7 bits (71), Expect = 0.34 Identities = 21/90 (23%), Positives = 45/90 (50%) Frame = -1 Query: 527 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD 348 EE+ER+ E +K E+ K++ET++ K L+ +E+E+ + + + ++Q Sbjct: 285 EELERLKEEKDKMLEEELKKRETLEEKQKLQD------KILEEERKRLENLEKERQAAQQ 338 Query: 347 KCNDTIKWLDSNQLADKEEYEHKQKELEGI 258 + L + + A K+ E +K++ I Sbjct: 339 AMQEAHDKLAAAEEAAKKASEEAKKKVREI 368 >SB_25234| Best HMM Match : SMC_hinge (HMM E-Value=3.7e-28) Length = 552 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -1 Query: 497 EKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIK 327 E+ D QKE QA +E Y S++ E KE + S+K+ + ++C + IK Sbjct: 13 EESTRAGDLQKEVTQASENIEKYSQSIRDLGE----KENVLTSEKKQLEEECQENIK 65 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/89 (20%), Positives = 46/89 (51%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K+E++ + E+ + ++QK+ +Q + E K +++E+ K+++ + KQ + Sbjct: 88 KQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQ-EEQKQEVQEEQ-KQEVQEEQKQEVQ 145 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELE 264 ++ ++ + +E+ E KQ+E E Sbjct: 146 EEQKQEVQ----EEQKQEEQEEQKQEEQE 170 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/109 (14%), Positives = 52/109 (47%) Frame = -1 Query: 590 EVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 411 E + ++ L + K+E++ + E+ + ++QK+ +Q + E K Sbjct: 7 EKQEEQQQNQELEEQQQKEQKQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQ-EEQKQ 65 Query: 410 TMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 +++E+ K+++ KQ ++ ++ + ++++ E +++E++ Sbjct: 66 KVQEEQ-KQEVQKEQKQEEQEEQKQEVQEEQKQEEQEEQKQEEQKQEVQ 113 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/87 (18%), Positives = 40/87 (45%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K+E ++ + E+ + E ++QK+ +Q + E + E++K + + ++ Sbjct: 104 KQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEEQEE 163 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKE 270 K + + Q K+E + +QK+ Sbjct: 164 QKQEEQEEQKQEVQEEQKQEVQEEQKQ 190 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 31.9 bits (69), Expect = 0.60 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -1 Query: 419 MKSTMEDEKLKEKISDSDKQTILDKCNDTIKW-LDSNQLADKEEYEHKQKELEGIYNPII 243 +++ + EK K + D +++ L + T+K+ LD +LA KE++ +KE EG + Sbjct: 100 VENDRDSEKHKRDLRDKEQE--LSELRKTVKYALDQEKLA-KEQFGDLKKEFEGYKKKMD 156 Query: 242 TKM 234 TKM Sbjct: 157 TKM 159 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 31.9 bits (69), Expect = 0.60 Identities = 28/104 (26%), Positives = 56/104 (53%), Gaps = 7/104 (6%) Frame = -1 Query: 548 TKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 369 +++ + E+I +E + +N DK + + ++ E S K ++ +K ++ D Sbjct: 137 SELQNSSEKISEDEHEISQLKN--DKARCMQELRDEREK---SNKLVVDLQKTRKAQDDC 191 Query: 368 DKQTILDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 258 +K+ +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 192 EKE--VNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.9 bits (69), Expect = 0.60 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = -1 Query: 506 NEAEKYRN-EDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTI 330 N EK +N E K K + + A E S++ ++ E+ EK ++T D+ N TI Sbjct: 1658 NNHEKEQNIESIKDKLWAEFEEAKED---SVREALDSER--EKWRKEYEKTTQDEINKTI 1712 Query: 329 KWLDSNQLADKEEYEHKQ 276 +L+ EE++HK+ Sbjct: 1713 SYLEDQYTRGLEEFKHKE 1730 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/116 (22%), Positives = 47/116 (40%), Gaps = 4/116 (3%) Frame = -1 Query: 599 RYREVHQXRRTRSP---LPTTKVVSPKEEIERMVNEAEKYRNED-DKQKETIQAKNALES 432 + R+ RR+RSP + V E+ R EK + DK K+ + + + Sbjct: 278 KQRDKSDDRRSRSPERKIKEDSVTKSDEDEGRSSERREKEEKKSRDKDKDRERERKDKKD 337 Query: 431 YCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 + +K ++K D DK+ +K + K D + DK+ K ++ E Sbjct: 338 RDRGRNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKE 393 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 344 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 234 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 1/93 (1%) Frame = -1 Query: 545 KVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALE-SYCFSMKSTMEDEKLKEKISDS 369 K S E++E+ NEAEK N K+KE + ++ + KS++ +E + S Sbjct: 175 KKTSEIEDLEKERNEAEKKYNSLRKEKENLVSELTKKFEMLEGQKSSLVEENKVLQDSVK 234 Query: 368 DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 D + L K N + + + EE E +K+ Sbjct: 235 DLKIRLKKSNQDLNKITEELKSTLEEIEMVKKK 267 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/115 (22%), Positives = 56/115 (48%), Gaps = 1/115 (0%) Frame = -1 Query: 611 PQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 432 P R YRE + ++ + K K++ ++ N+ K +K+K+ ++ K E+ Sbjct: 8 PMRREYREEKKRKKKKQKKKKKK----KKKKKKKKNKKNKKNKNKNKKKKKMKKKKEEEA 63 Query: 431 YCFSMKSTMEDEKLKEKISDSDKQ-TILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 + T+E E +EKI +++K+ +K + K + ++EE E +++E Sbjct: 64 EVG--EKTLEAENEEEKIEETEKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEE 116 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/101 (25%), Positives = 46/101 (45%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K+E ER+ +AEK + K+KE ++ K E K E+EK K+ ++ I Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKK------EEEIN 398 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMXP 228 K + K + + ++E+ + K++ N IT P Sbjct: 399 AKIEEKKKREEKKKQEEEEKMKKKEQAKNNFVNFFITAPAP 439 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 K E+E+ E EK R E +KQ+ + K LES ++ + + EK + ++ ++ Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILESKQKRIEESKDTIHDNEKFLEEQRKRLV 282 Query: 350 DK 345 +K Sbjct: 283 EK 284 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/85 (21%), Positives = 41/85 (48%) Frame = -1 Query: 632 RHRCQRYPQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQ 453 R R ++ Q+ + +E + R + + + ++E ++ E EK ++++ K+KE + Sbjct: 307 RKRQEKLEQKAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQR 366 Query: 452 AKNALESYCFSMKSTMEDEKLKEKI 378 K LE E ++ KE++ Sbjct: 367 EKEKLEKEKQKELERKELQRQKERM 391 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNED--DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQT 357 K+E ER E EK R ++ ++KE + + E K E ++ KEK+ + +KQ Sbjct: 319 KKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQEKKEKERQREKEKL-EKEKQK 377 Query: 356 ILDK 345 L++ Sbjct: 378 ELER 381 >SB_16769| Best HMM Match : DUF1690 (HMM E-Value=0.17) Length = 837 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -1 Query: 548 TKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKS 411 TK V +EE E AE DD Q++ +A ALE+ S+KS Sbjct: 154 TKTVVQREEAEAAKKAAETQAIADDAQRDLDEALPALEAALASLKS 199 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 8/77 (10%) Frame = -1 Query: 467 KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD------KCNDTIKWL--DSN 312 KE +Q + L ++ + K +E EK+ IS +D + +L+ K + I+ L + + Sbjct: 299 KERLQIERKLANFTKTSKKEVESEKV---ISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 311 QLADKEEYEHKQKELEG 261 QL + +++H +KELEG Sbjct: 356 QLQENSKHKHFEKELEG 372 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 30.7 bits (66), Expect = 1.4 Identities = 27/125 (21%), Positives = 59/125 (47%), Gaps = 6/125 (4%) Frame = -1 Query: 620 QRYPQRFRYREVH----QXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQ 453 QR + RY+E+ + RR + + ++ I R EAE+ R E +++++ + Sbjct: 485 QREKELKRYKELQMAEEEKRRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVP 544 Query: 452 AKNALESYCFSMKSTMEDEKLK-EKISDSDKQTILDKCNDTIK-WLDSNQLADKEEYEHK 279 +ALE C + + ++K +K+ + ++ + +K + +L +K + E Sbjct: 545 HSDALE--CAIKPLNLLEARIKAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKA 602 Query: 278 QKELE 264 Q+E E Sbjct: 603 QRERE 607 Score = 30.3 bits (65), Expect = 1.8 Identities = 22/86 (25%), Positives = 42/86 (48%) Frame = -1 Query: 620 QRYPQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNA 441 +R + R R+ + R+ + KEE ER+ EAE+ R ED++Q+ + + A Sbjct: 387 RRAEAKERERQEEERRKGEERQRQEEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA 446 Query: 440 LESYCFSMKSTMEDEKLKEKISDSDK 363 E +K M+ K + + ++ D+ Sbjct: 447 -EDERQRVKHEMQRLKDERRRAEEDE 471 Score = 27.9 bits (59), Expect = 9.8 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = -1 Query: 605 RFRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNED-DKQKETI-QAKNALES 432 R + +++ + +R L + K+E+ER+ EK + E +++E I Q KN Sbjct: 562 RIKAQKLEEEQRELERLQAEAELKRKQELERL---REKRKEEKAQRERELIEQEKNRARE 618 Query: 431 YCFSMKSTMEDEKLKE 384 S+K E K KE Sbjct: 619 IYISLKRVREQVKQKE 634 >SB_45735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 30.7 bits (66), Expect = 1.4 Identities = 25/106 (23%), Positives = 46/106 (43%), Gaps = 2/106 (1%) Frame = -1 Query: 548 TKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 369 TK ++ ++V EA + +++ +K + ALE Y + + + E + Sbjct: 273 TKQTETLRKLTKLVQEARQNHDDESVKKAVNEYDEALERYIPVLMAQAKIYWDLENYAQV 332 Query: 368 DK--QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITK 237 +K + ++ CN+ W N E+K KE G Y PI+ K Sbjct: 333 EKIFRKSVEFCNEHEVW-KLNVAHVLFMQENKYKEAVGFYEPIVKK 377 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -1 Query: 581 QXRRTRSPLPTTKV-VSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 405 Q +R ++ T+ V K+E R+ +EAEK E++K K+ + + + Y ++ + Sbjct: 449 QRKRVQNKDAATRYRVKKKDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEV 508 Query: 404 EDEKLKEKIS 375 K K+K S Sbjct: 509 YQTKQKQKES 518 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKQ 360 KE+I+ NEA++ + DK +KE +KN LES +K+ ++ +E I+ ++Q Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKTKQSQLQRNQEDIAKLEQQ 60 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMEDEKLKEKISDSDKQTI 354 + E+E+ E EK DK+K+ ++ N L S+ S + DE KE +D+ Q I Sbjct: 837 RSELEKAKGEIEKAWTLYDKEKDRLEKLNGQLIDELKSLTSVL-DEMKKESENDAQCQKI 895 Query: 353 LD 348 LD Sbjct: 896 LD 897 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/93 (23%), Positives = 46/93 (49%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S + Sbjct: 56 REEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNSSAKMTR 110 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQKELEGIYN 252 + + +LA ++E KQK+ E I++ Sbjct: 111 AQITE-----HQAKLAAEQEKLQKQKQQETIHD 138 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 6/93 (6%) Frame = -1 Query: 602 FRYREVHQXRRTRSPLPT--TKVVSPKEEIERMVNEAEKYRNEDDK---QKETIQAKNAL 438 F R+ Q + +S + T++ + K E+ER VNE + + +K ++ ++ K Sbjct: 213 FGMRKALQAEQGKSDMERKITELENDKRELERQVNELKAKCDAIEKREAERRAVEEKKHA 272 Query: 437 ESYCFSMKSTMEDEKLKEKISDSD-KQTILDKC 342 E F +K T +++LK+K+S+ D + + KC Sbjct: 273 EEIQF-LKRT--NQQLKQKMSEPDSSKWVACKC 302 >SB_54255| Best HMM Match : DUF329 (HMM E-Value=7.8) Length = 82 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -1 Query: 416 KSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL 267 K T ED++ ++K ++SD Q + N T K +L + +E K+ EL Sbjct: 33 KVTQEDQEPEKKSNESDPQKDQETDNKTSKKESQEELREADETPKKKDEL 82 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 177 PEPEVPPPGLEALAPPSRRSIKP-TFHTTLKPTCNNHLVTSP 55 P+P+ PPPG PPS + P T +P VT P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP 69 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = -1 Query: 581 QXRRTRSPLPTTKVVSPKEEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTM 405 + R R+ ++ E+ E+++ + AEK R +K+KE + E F + + Sbjct: 1428 ERERRRAQKEKEDLIYDHEKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSK 1487 Query: 404 EDEKLKEKISD 372 +DE L +K+ D Sbjct: 1488 KDEDLAQKLQD 1498 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -3 Query: 228 RVPEESPEVCRASRAEHPEPEVPPPGLEALAPPS 127 R PE+ EV S + P L+ L PPS Sbjct: 28 RFPEDDLEVSSVSASASSSTSRPTNALQPLKPPS 61 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 141 LAPPSRRSIKPTFHTTLKPTCNNH 70 L PPSR+S P HT P+C ++ Sbjct: 80 LTPPSRQSNNPRPHT--PPSCQSN 101 >SB_32124| Best HMM Match : K-box (HMM E-Value=4.1) Length = 207 Score = 29.1 bits (62), Expect = 4.2 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -1 Query: 536 SPKEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSD 366 S K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ Sbjct: 135 SQKIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESN 193 Query: 365 KQTILDKCND 336 + KC D Sbjct: 194 LEDAEKKCKD 203 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 29.1 bits (62), Expect = 4.2 Identities = 26/107 (24%), Positives = 47/107 (43%) Frame = -1 Query: 584 HQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTM 405 H ++ RS T+ EE ER +E +N+D + +E + K E + Sbjct: 397 HHHKKKRSHSKTSSTTD--EEKERKKSET---KNKDSEDEEKERKKREAEE---EEERRR 448 Query: 404 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 E+E+ +E+ ++ + + K + + +EE E KQKE E Sbjct: 449 EEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKE 495 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQ 360 +EE ER E K E+ KQ+E + K E + E+E+ K+K + +K+ Sbjct: 448 REEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEEERKQKEKEEEKK 499 >SB_1024| Best HMM Match : Ank (HMM E-Value=0) Length = 891 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 222 PEESP--EVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPT 106 PE+ P EV A R E P+ E PP +PP ++ KPT Sbjct: 771 PEQPPIGEVESAVRREQPKSEKTPPSTTP-SPPPKQPSKPT 810 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -1 Query: 560 PLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKE---TIQAKNALESYCFSMKSTMEDEKL 390 P+P KV ++ + V++ + N+DDK+KE + E++ SM+ + D++ Sbjct: 970 PIPHYKVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEETEAHIISMQEEVNDDET 1029 Query: 389 KEK 381 +E+ Sbjct: 1030 EEE 1032 >SB_37346| Best HMM Match : Extensin_2 (HMM E-Value=0.62) Length = 331 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 617 RYPQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMV 507 RYP+ R ++ R RSP+ +T+ SP+ + + V Sbjct: 51 RYPRGHRKSQIPPWTRARSPVDSTRAKSPRGQCQSKV 87 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 213 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTS 58 S + C A+ P + L+ P S S +PT TL CNN TS Sbjct: 417 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNNFTTTS 468 >SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) Length = 348 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 617 RYPQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMV 507 RYP+ R ++ R RSP+ +T+ SP+ + + V Sbjct: 208 RYPRGHRKSQIPPWTRARSPVDSTRAKSPRGQCQSKV 244 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 29.1 bits (62), Expect = 4.2 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -1 Query: 536 SPKEEIERMVNEAEKYRNE-DDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS--DSD 366 S K +IE + E + E DD Q+ET K L SY MKS +K ++ +S+ Sbjct: 872 SQKIKIEELEVRIEDLKEENDDYQQETKYLKQVL-SYREDMKSVQVSQKATRQLQKLESN 930 Query: 365 KQTILDKCND 336 + KC D Sbjct: 931 LEDAEKKCKD 940 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 264 RHLQSDNYEDVXRVPEESPEVCRASRA-EHPEPEVPPPGLEALAPPSRRS 118 + L+S + +D + E P V + R E +P PPP APP ++ Sbjct: 320 QRLESKDTKDDEPMEIEPPNVTKPDRTTEQTQPSPPPPETVTTAPPLHKT 369 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -1 Query: 488 RNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQ 309 +N E + + + SY K + EK KEK + +K+ ILD K++ N Sbjct: 1081 KNSQTPLLEILSPRKDIGSYKSCPKLRKKREKEKEKDKEKEKEVILD-FEALDKFIGRNP 1139 Query: 308 LADKEEY-EHKQKELEGI 258 + E+ E + ELE I Sbjct: 1140 MTQIAEFREAEAAELEAI 1157 >SB_36001| Best HMM Match : CheD (HMM E-Value=3.9) Length = 313 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/95 (21%), Positives = 46/95 (48%) Frame = -1 Query: 554 PTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 375 P+ +V+ + ++ M N+ E +E+D++ + I+ +NA+E + + LKE S Sbjct: 216 PSVEVLENLDILDEMSNDVE---DEEDEEDDAIEKENAIED-----EDNLYAIILKEYFS 267 Query: 374 DSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 ++D ++ + L N + D++ + E Sbjct: 268 ETDTESEDENRQPRTDSLSVNDINDRQVETRSENE 302 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/55 (23%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -1 Query: 404 EDEKLKEKISDSDK-QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 243 ++E L++++S+ ++ Q ++++ N+T+K L +K+E K L+ +N ++ Sbjct: 31 DNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKDELTLTIKTLQEEFNTML 85 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 28.7 bits (61), Expect = 5.6 Identities = 23/110 (20%), Positives = 48/110 (43%) Frame = -1 Query: 593 REVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMK 414 RE+ + + + E+ ++ + E + Q E +A+ E+ Sbjct: 132 REIEAETEKEAETEKEAQTEKEAQTEKEAGTEKEAQTEKEAQMEK-EAETEKEAQTEKEA 190 Query: 413 STMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 T E E +EK ++++K+ +K +T K + + A+ ++ KQKE E Sbjct: 191 QT-EKEAEREKEAETEKEAKTEKEAETEKEAQTEKEAETQKEAEKQKEAE 239 >SB_22161| Best HMM Match : Vicilin_N (HMM E-Value=0.11) Length = 489 Score = 28.7 bits (61), Expect = 5.6 Identities = 37/160 (23%), Positives = 64/160 (40%), Gaps = 12/160 (7%) Frame = -1 Query: 635 LRHRCQRYPQRFRYREVHQXRRTRSPL-----PTTKVVSPKEEIERMVNEAEKYRNEDDK 471 L H QRY +R R+ E+ Q + P + V K + E + ++ R E+ Sbjct: 44 LEHEVQRYKERERHMEIVQLLEKKRPWAEYEEARKQFVDLKTKREDAKKQLDQCRRENAP 103 Query: 470 QKETIQA-KNALESYCFSMKSTME---DEKLKEKISDSDKQTILDKCNDTIKWLDSNQLA 303 ++ + A L +MK E + K K + ++DK + L Q Sbjct: 104 MEQQLNAIVQHLCQLDRNMKQQAEKGSETHRKAKAKSDQLEALVDKIEEQQNHLKDMQ-- 161 Query: 302 DKEEYEHKQ-KELEG--IYNPIITKMXPGCRRSPRRYAGL 192 D+E+ HK L G ++ P I ++ R+ R+ L Sbjct: 162 DEEKRRHKNFSTLIGKLLFQPKIEEISGNARQLNRQITAL 201 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.7 bits (61), Expect = 5.6 Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQ----KETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 363 KE+ E+M E ++ ++ DK+ KE + ++ E M ++E KE + D+ Sbjct: 23 KEDKEKMDKEDKEEMDKQDKENKEDKEEMDKEDKEEMDQEEMDKEDKEEMDKEDKEEMDQ 82 Query: 362 QTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 + +DK + +D DKEE + ++ + E Sbjct: 83 EE-MDKEEMDQEEMDKEDKEDKEEMDQEEMDKE 114 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 28.7 bits (61), Expect = 5.6 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 13/97 (13%) Frame = -1 Query: 524 EIER--MVNEAEKYRNED------DKQKETIQAKNALESYCFSMKSTMEDEKL-----KE 384 EIE+ +++AE + NED D E A E ++ E E++ E Sbjct: 1413 EIEKASQIDQAEDFPNEDEVPAVIDLLPENSSAFGISEEKIDGIQEAKESEEIVSSGETE 1472 Query: 383 KISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQK 273 +I D D ++D ++ L ++ D+EE E ++K Sbjct: 1473 EIEDEDTPVVVDILSEDTSALGISEERDEEEIEQQKK 1509 >SB_24424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/57 (22%), Positives = 28/57 (49%) Frame = +3 Query: 570 SPXLVDFSIAETLRIPLASMSKVTSXLRHATRRRWXSGSARIYRASCYLXVIARSPL 740 +P + DF + E ++ + + + S LR+ + W GSA + + +++R L Sbjct: 52 NPCVTDFELEEFIKDIVVARDQGISPLRNVSVPSWEFGSAFFFAGTVITTIVSREDL 108 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = -1 Query: 617 RYPQRF--RYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKN 444 R P++F ++ V + + V EE+E N+ ++ +DDK++ET K Sbjct: 11 RSPKKFSWNHKMVKKKEKKNKLAALAAAVEAAEEVE---NKMDEMSVKDDKREETQSDKK 67 Query: 443 ALESYCFSMKSTMEDEK 393 + + S EDEK Sbjct: 68 SAKESTKSSSKPAEDEK 84 >SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) Length = 425 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/80 (23%), Positives = 37/80 (46%) Frame = -1 Query: 599 RYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFS 420 R +V Q R +P T +E+E + E+ D++KE ++ + AL S Sbjct: 225 RIVQVAQLRTELGSIPDTNPEKKIQELENTIKHHEEKTEVSDQEKEKLRERIALLEEAIS 284 Query: 419 MKSTMEDEKLKEKISDSDKQ 360 + + ++L+E S D++ Sbjct: 285 HRQD-KIQRLEENGSTLDRR 303 >SB_12462| Best HMM Match : Kinesin (HMM E-Value=0) Length = 803 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = -1 Query: 521 IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKC 342 I+R+ N + Y+ E D +E + E Y S++ + KL+++I D + I C Sbjct: 569 IDRLENRLQSYQVEIDDLQEEFERDR--EDYLDSIRKQEQTIKLQQQIIDKIQPCIRRDC 626 Query: 341 N 339 N Sbjct: 627 N 627 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/85 (24%), Positives = 47/85 (55%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTIL 351 KEE + E EK + ED+ ++E + +E+ +K +EDE K+++ + +K+T Sbjct: 642 KEEERKRREEEEKKKREDEVKREEEGRRQKVEA---ELK-LIEDEH-KQRLEELEKKTKK 696 Query: 350 DKCNDTIKWLDSNQLADKEEYEHKQ 276 ++ + +++++ D+ + E KQ Sbjct: 697 EEEKKRSEHVNNDEELDRLQEEIKQ 721 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Frame = -1 Query: 416 KSTMEDEKLKEKISDSDK-------QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 258 K T + EK KEKI +K QT+LDK + + + +L K ++HK+ E Sbjct: 837 KGTEKQEKEKEKIQKEEKEPEKSKVQTLLDKLHRQARVEEEVKLVLKVYFKHKEITKEE- 895 Query: 257 YNPIITKMXP 228 Y I+ + P Sbjct: 896 YKSILRRAVP 905 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 28.3 bits (60), Expect = 7.4 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%) Frame = -1 Query: 530 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS-----D 366 + +E +NE EK D + Q KN E C + +T E +K +++S+S + Sbjct: 805 RAHLESDINEKEKEIERKDNALKEFQEKNK-ELEC-QLAATGELKKTVDELSNSITLRDE 862 Query: 365 KQT-ILDKCNDTIKWLDSNQLADKEEYEHKQK 273 K T I ++ T++ + A KEE K+K Sbjct: 863 KITKIKEQLKQTLEKFKEKEKALKEEIAEKEK 894 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 201 CRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPT 82 C A A+ P+ +VPPP APP + P TT PT Sbjct: 92 CNAKPAQ-PDTDVPPPPATTSAPPPPTTTAPP-ATTSPPT 129 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 28.3 bits (60), Expect = 7.4 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 2/84 (2%) Frame = -1 Query: 599 RYREVHQXRRTRSPLPTTKVVSPKEEIER-MVNEAEKYRNEDDKQKETIQAKNALESYC- 426 +YRE + RTR + TT++ + +E R +V E E+ +E + ++ I A E+ Sbjct: 124 KYREQTEDLRTRLRM-TTELCAKQEAYYRDIVKELEERLHETIEGRDHILALRESEAASQ 182 Query: 425 FSMKSTMEDEKLKEKISDSDKQTI 354 ++ +E LK+K S +DK + Sbjct: 183 LNLVKQLEAALLKQKQSAADKDQL 206 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.3 bits (60), Expect = 7.4 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 3/87 (3%) Frame = -1 Query: 524 EIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD 348 +++ + A + + DK + IQ +NA +S +KSTM +K K+ D ++ Sbjct: 519 QVDNLAQLASSLKKDKDKVSKQIQDLRNATQSAIKKIKSTM----MKRKMIDEVYCDLVK 574 Query: 347 KCNDTIKWLDSNQLADK--EEYEHKQK 273 + N + L+ Q K EE E +K Sbjct: 575 RVNHHLADLNERQKQQKIAEEQERLRK 601 >SB_23579| Best HMM Match : PspA_IM30 (HMM E-Value=1.5) Length = 207 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/94 (20%), Positives = 41/94 (43%) Frame = -1 Query: 524 EIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDK 345 +I +MVN + +D + E + ++ K M+ L +++ +K +D+ Sbjct: 23 KIVQMVNNTARVTRKDARDTEA----SCVDVSLSVRKKNMDILHLNDEVKRYEKLLAMDR 78 Query: 344 CNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 243 L+ + E EHK +ELE ++ ++ Sbjct: 79 KLPRRSILEERLGRAEAELEHKDRELENLHKQVV 112 >SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/74 (24%), Positives = 31/74 (41%) Frame = -1 Query: 602 FRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCF 423 FR+R V + LP T V+P E + EK ED ++ K ++ C Sbjct: 160 FRHRHVSEKVPHVEELPQTPEVNPPLEQGQTAVRTEKPLREDRSNRDLSFLKYFVDEVCR 219 Query: 422 SMKSTMEDEKLKEK 381 +++++ EK Sbjct: 220 GYVLELDEDRYAEK 233 >SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) Length = 1146 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -3 Query: 213 SPEVCRASRAEHPEPEVPPPGLEALAPPSRRSIKPTFHTTLKPTCNNHLVTSP 55 S + C A+ P + L+ P S S +PT TL CNN TSP Sbjct: 84 SEQYCYFGDAKVPATFMNDTTLKCTVPTSSVSSRPTVAVTLNGGCNN-FTTSP 135 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 28.3 bits (60), Expect = 7.4 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -1 Query: 515 RMVNEAEKYRNEDDKQK-ETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCN 339 R EAE+ R E +K+K E +A+ + + ++E+LK + D +++ K Sbjct: 190 RFEQEAERRRREAEKRKAEEEEARRKADELEKIKRQQEDEERLKNQRLDEERK----KLE 245 Query: 338 DTIKWLDSNQLADKEEYEHKQKELE 264 + L + KEE E K++E E Sbjct: 246 EEEANLMEEERKRKEEAEKKREEEE 270 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.3 bits (60), Expect = 7.4 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = -1 Query: 530 KEEIERM--VNEAEKYRN-EDDKQKETIQAK--NALESYCFSMKSTMEDEKLKEKISDSD 366 KEEIE NE E+ EDD +KE I+ + + + + E+E+++E+ D D Sbjct: 157 KEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEEREDDDD 216 Query: 365 KQTILDKC-NDTIKWLDSNQLADKEE 291 + D+ ND + + ++ D + Sbjct: 217 EVEERDETENDNDEGEEREEMEDDND 242 >SB_47339| Best HMM Match : Rubredoxin (HMM E-Value=0.76) Length = 730 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -3 Query: 333 HQVAGFQPAGRQGGV*-AQAERIGRHLQSDNYEDVXRVPEESPEVCRASRAEHPEPEVPP 157 H+V +P GR G V + +R R L D+ + + P VC + + VPP Sbjct: 328 HRVVKSRPDGRGGTVQWSYCQRFRRCLDCGKVLDLHKAEPDKPHVCGEYKCRTCDDVVPP 387 Query: 156 PGL 148 L Sbjct: 388 DHL 390 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 28.3 bits (60), Expect = 7.4 Identities = 25/103 (24%), Positives = 50/103 (48%), Gaps = 2/103 (1%) Frame = -1 Query: 536 SPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKI--SDSDK 363 SPKE+ E + E E + K+K ++ K E + K ++D++L+EK+ +D Sbjct: 231 SPKEKEEMLSEELETQKELLIKEKHKVEEKLQNE---LNQKLELKDKELEEKLLAQKADL 287 Query: 362 QTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKM 234 + ++ + K L +L+ + K K+LE ++T + Sbjct: 288 EKVIAEKEAQQKEL-QQELSIHKSATEKLKDLEENEKRLVTSV 329 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = -1 Query: 590 EVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEK--YRNEDDKQKETIQAKNALESYCFSM 417 ++H+ R ++P K + K+ E+ V + E+ + + +K + + K Sbjct: 276 KIHKKDREKTPTKKNKEKNVKKNEEKDVQKEEEKDVQKKVEKSAKHLPQKKPESKKHEQT 335 Query: 416 KSTMEDEKLKEKISDSDK 363 K ++ KLK ++SD +K Sbjct: 336 KKDLKGRKLKRQLSDKEK 353 >SB_38303| Best HMM Match : Fz (HMM E-Value=9.8e-07) Length = 528 Score = 28.3 bits (60), Expect = 7.4 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 4/115 (3%) Frame = -1 Query: 545 KVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK--LKEKISD 372 KV EE + + + KY K + T KNA ES + + K ++EK + Sbjct: 102 KVECKSEEACKPIEKHSKYDMSIFK-RSTNGLKNADESQSSVNRLNDDSNKTLIREKRHE 160 Query: 371 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKEL--EGIYNPIITKMXPGCRRS 213 S +C +LD+ +L + Y K EL +G + + TK+ P CR S Sbjct: 161 SCHHYHGRQCTS---FLDTKRLLYFDHYPPKSIELGLKGPFKSLRTKLSPKCRAS 212 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = -1 Query: 527 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 363 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_7914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -1 Query: 404 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 EDE+ E SD D +T +++ +D ++ D+EE HK +E Sbjct: 118 EDEEKTESESDDDDKTEKYSDDESDVSMDGDESDDEEEGPHKPEE 162 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.9 bits (59), Expect = 9.8 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Frame = -3 Query: 225 VPEESPEVCRASRAEHPEPEVPP----PGLEALAPPSRRSIKPT-FHTTL--KPTCNNHL 67 VP ++P ++S A +P P+ PP A P ++ S PT +TL P+ H Sbjct: 789 VPTQAPTEMKSSTARNPPPKKPPNPTKQSATAPTPSTQGSQSPTGSASTLGENPSPTTHY 848 Query: 66 VTSP 55 T P Sbjct: 849 ATKP 852 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 27.9 bits (59), Expect = 9.8 Identities = 27/119 (22%), Positives = 54/119 (45%) Frame = -1 Query: 620 QRYPQRFRYREVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRNEDDKQKETIQAKNA 441 +R Q+ R RE + + KV S E + A+K E++++++ + Sbjct: 228 ERLEQQRRQREQRIAEKRKRLEEQRKVESLHLLKELLKRVADKRAEEEEEKRKREKELEM 287 Query: 440 LESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 264 L + E+E++KE++ +KQ + K K L L + +E + +++ELE Sbjct: 288 LRQIEEKKRKLEEEERIKEEV---EKQKKI-KLEQQEKELRDKLLKNLKEMKERKQELE 342 >SB_47024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 27.9 bits (59), Expect = 9.8 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = -1 Query: 518 ERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILDKC 342 E++ E E+Y +QKE + K + + ++KS E+ K KEK+S ++Q L+ Sbjct: 123 EQLQLERERYATASLTQQKEALSEKLSQITLRQNLKSHKEEAKNKEKLS-KERQKKLENM 181 Query: 341 NDTIKWLDSNQLADKEEYEHKQKELE 264 + + EE +QKE+E Sbjct: 182 LQSERQRCVEYQRLYEEQVLRQKEME 207 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = -1 Query: 446 NALESYCFSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 270 +AL+ Y + ++ EKLKE I D K +LD+ ++W+ + ++ + ++KE Sbjct: 852 SALDLYVLIPPANIK-EKLKEDIHDPHK--VLDRVKYRVEWVKHQEKEKQKLEDEREKE 907 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -3 Query: 177 PEPEVPPPGLEALAPPSRRS--IKPTFHTTLKPTCNNHLVTSP*LK*INIE 31 P P PPPG E PP + + PT P V+ P K N++ Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKSANMD 182 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 9.8 Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 4/106 (3%) Frame = -1 Query: 593 REVHQXRRTRSPLPTTKVVSPKEEIERMVNEAEKYRN----EDDKQKETIQAKNALESYC 426 +E + + R L K +EE R NE K R E +KQ++ K Sbjct: 151 KEEEEKEKQRKQLEVEKQKRLEEERIRSQNEERKRREREQKEREKQQKLDMEKEERRRRQ 210 Query: 425 FSMKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEY 288 + +E+ K K + +KQ IK Q D+++Y Sbjct: 211 QEEEKKRREEEEKRKKVEKEKQEREKAAKKNIKRQQQQQRTDQQQY 256 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/88 (21%), Positives = 40/88 (45%) Frame = -1 Query: 527 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKQTILD 348 EE E E E+ E+++Q E + + E + + E+EK + K D +++ + D Sbjct: 72 EEEEEQTEEEEEQTEEEEEQTEEEEEQTEEEEEQ-TEEEEEEEEKEEGKEEDGEEEVVTD 130 Query: 347 KCNDTIKWLDSNQLADKEEYEHKQKELE 264 + + +SN+ + E + + E Sbjct: 131 ERGISSSKDESNESDESNESDESNESDE 158 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = -3 Query: 177 PEPEVPPPGLE-ALAPPSRRSIKPTFH 100 P P PPP L A APP R P H Sbjct: 425 PPPPPPPPALRLACAPPRLRFTSPVLH 451 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,809,063 Number of Sequences: 59808 Number of extensions: 423152 Number of successful extensions: 2153 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 1819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2122 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -