Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_T7_J01
         (764 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9R6H2 Cluster: Tiorf87 protein; n=2; Rhizobiales|Rep: ...    35   1.9  

>UniRef50_Q9R6H2 Cluster: Tiorf87 protein; n=2; Rhizobiales|Rep:
           Tiorf87 protein - Agrobacterium tumefaciens
          Length = 358

 Score = 35.1 bits (77), Expect = 1.9
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +1

Query: 613 GGANMPLAWTECSVASGSAVDAISSPTGAS*ASLVRYAAGSSP 741
           GG+N+  AWTE  V SG     ++ P GA   S      GS P
Sbjct: 61  GGSNIAAAWTEREVVSGQLHGTLTLPKGAGQVSAALILPGSGP 103


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 594,311,490
Number of Sequences: 1657284
Number of extensions: 9834259
Number of successful extensions: 17962
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17961
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)