BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I23 (813 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 3.8 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 22 6.7 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 6.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 3.8 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 557 ESCFTFACPKFLSACPPPIEPGANYGRDAVKHQTQVFMDEV 435 E C T+AC + C I P AN A +VFMD + Sbjct: 504 EECNTYACEFDGNDCSLGINPWANC--TASTRCWEVFMDGI 542 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 36 LFVNVLIQWPF*ILIWC 86 LF+N+ +WP + WC Sbjct: 101 LFLNLAKRWPKFVKDWC 117 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 36 LFVNVLIQWPF*ILIWC 86 LF+N+ +WP + WC Sbjct: 101 LFLNLAKRWPKFVKDWC 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,553 Number of Sequences: 336 Number of extensions: 4155 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22206566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -