BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I20 (829 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 38 0.013 SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) 37 0.017 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 37 0.023 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) 36 0.030 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.093 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 32 0.49 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 32 0.49 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.65 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.65 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 32 0.65 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 32 0.65 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 31 0.86 SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) 31 1.1 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 31 1.5 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 31 1.5 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 30 2.0 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 30 2.0 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 30 2.0 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 30 2.0 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 30 2.0 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 30 2.0 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 30 2.0 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 30 2.0 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 30 2.6 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 30 2.6 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 30 2.6 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 30 2.6 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 30 2.6 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 29 4.6 SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) 29 4.6 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 29 6.1 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 29 6.1 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 29 6.1 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 6.1 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 29 6.1 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 6.1 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 29 6.1 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 29 6.1 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 29 6.1 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 29 6.1 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) 28 8.0 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 28 8.0 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 28 8.0 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 28 8.0 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 28 8.0 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 37.5 bits (83), Expect = 0.013 Identities = 39/133 (29%), Positives = 58/133 (43%), Gaps = 4/133 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P I+ YK+ + P + YAS + + ++K ++ +Q R R P + N+ Sbjct: 138 PENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVTNCWDRTPGTVTNI 197 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKHVIT 317 +DLE SK Q+A L F KA ++ L IPD +DR R+ R H Sbjct: 198 --LNDLEWPPLSKRRQNARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH--- 245 Query: 316 DPPDPLTVLLGTT 278 PD L TT Sbjct: 246 --PDKFIELCPTT 256 >SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) Length = 237 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 4/117 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P + YKT + P + YAS + + ++K ++ +Q R R P + N+ Sbjct: 111 PETFKEAAYKTLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI 170 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 326 +DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 171 --LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH 218 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 36.7 bits (81), Expect = 0.023 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 4/113 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P+ I+ YK+ + P + YAS + + ++K ++ +Q R R P + N+ Sbjct: 544 PANIKEAAYKSLVHPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI 603 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRR 338 +DLE SK Q A L F KA ++ L IPD +DR + R Sbjct: 604 --LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRRTRQLR 648 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 36.3 bits (80), Expect = 0.030 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 4/117 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P+ I+ YK+ + P + YAS + + ++K ++ +Q R R P + N+ Sbjct: 809 PANIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRSGRFVKNCWDRTPGTVTNI 868 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 326 +DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 869 --LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRR-TRQLRSSH 916 >SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) Length = 263 Score = 36.3 bits (80), Expect = 0.030 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 4/118 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P I+ YK+ + P + YAS + + ++K ++ +Q R R P + N+ Sbjct: 131 PENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI 190 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKHV 323 +DLE SK Q A L F KA ++ L IPD +DR R+ R H+ Sbjct: 191 --LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSHL 239 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 34.7 bits (76), Expect = 0.093 Identities = 19/39 (48%), Positives = 24/39 (61%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 L Y + IR V+ YASVVFA+ + SL+ IQ R RI Sbjct: 709 LVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 4/117 (3%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNV 497 P+ I+ YK+ + P + YAS + + ++K ++ +Q R P + N+ Sbjct: 247 PANIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGSFVKNCWDRTPGTVTNI 306 Query: 496 DLHDDLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 326 +DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 307 --LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRR-TRQLRSSH 354 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 530 Y TCIRP+M YA VF ++ L + L++I+ R RI Sbjct: 344 YLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 32.7 bits (71), Expect = 0.37 Identities = 22/69 (31%), Positives = 32/69 (46%) Frame = -3 Query: 281 HKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLLSGSRFRXRW*IQRSTALARVSVSN 102 H+ +P S+ + T + ELTH +SP S + L RFR R +L + N Sbjct: 224 HRVPNPGESHEAEETSSESFELTHENSPRHISVEDLPKGRFRSR-------SLVHPATRN 276 Query: 101 SPVEPRELT 75 V+PR T Sbjct: 277 FAVKPRSGT 285 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 32.7 bits (71), Expect = 0.37 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L LDS Sbjct: 440 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNLDSL 499 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 500 EVRRQLAQLCLFYK 513 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 L Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 427 LVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLK-SLQVIQSRFCRIA 527 Y TC+RP++ Y + +F H +K L+ IQ R IA Sbjct: 641 YNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKS-LQVIQSRFCRI 530 L Y TCIRPV YA VF H L + L+ Q R RI Sbjct: 1224 LFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/63 (22%), Positives = 32/63 (50%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNVDLHDDLELDS 467 + + I+P+M Y V+ + ++ ++Q R RI W+ ++ L ++L ++ Sbjct: 1 MFFNALIQPLMDYCITVWGDNLIEHDNTILLLQKRAARIIAYKKWYDHSMALFEELNIEP 60 Query: 466 FSK 458 F+K Sbjct: 61 FTK 63 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 L Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 362 LVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 Y + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 860 YLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 896 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 Y + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 451 YLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 487 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 Y + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 394 YLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 430 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/74 (21%), Positives = 35/74 (47%) Frame = -1 Query: 679 SKQTVPSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRN 500 +K + R + + I+P+M Y V+ ++ ++Q R RI W+ + Sbjct: 674 TKHFLSMTARKMFFNVLIQPLMDYCITVWGDNLIELDNTMLLLQKRAARIIPDKKWYDHS 733 Query: 499 VDLHDDLELDSFSK 458 + L ++L ++ F+K Sbjct: 734 MALFEELNIEPFTK 747 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 31.5 bits (68), Expect = 0.86 Identities = 52/169 (30%), Positives = 69/169 (40%), Gaps = 11/169 (6%) Frame = -3 Query: 695 IQCFVVEANCPLRNKVTXXQNLYTPRHDVCKRSVRSRSPHQLEI--PSGYSI---TILQD 531 + CFV LR K Q + D K +++ R P LE PS S T ++ Sbjct: 359 LTCFVFSNCTELRKKRIDLQLFVELKVD--KSAMKVRQPRDLEKSDPSPTSAVRTTEPEE 416 Query: 530 SRRSALVP*ECGS-PRRPGARLF**VSTVGIAAPF*EGGT--T*E---PSHRSRWKLHTR 369 SR VP P++P RL V A G T E P+ R+ L Sbjct: 417 SRIDVFVPAMFREKPKKPSHRLSPPARAVRSQASSASGQARMTVEYETPTLRTP-TLSAP 475 Query: 368 PSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTS 222 P RP G S K+ GS S + KH SPS S+ + TKG+T+ Sbjct: 476 PPRPQGNLLESLKSSE-GSMESTSNDSPLRKHSSPSLSDAIMRTKGTTN 523 >SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) Length = 646 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = -3 Query: 404 PSHRSRWKLHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGST 225 P+ R L T+P RPN P+ + + +S S GA ++K S S+ P L + S+ Sbjct: 75 PTTNVRLTLLTQPPRPNQDPN---RKTNRAASGSWCGARTYNKRASTLSTQPRL-YQDSS 130 Query: 224 SELTHRHSPLSFSP 183 E T +H + P Sbjct: 131 KEQTEQHQRVGAEP 144 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 577 YRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 612 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 533 P ++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 508 PESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 533 P ++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 90 PESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 1.5 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -1 Query: 691 NALWSKQTVPSV-IR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA- 518 N +KQ V S ++ Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 159 NEQLTKQIVLSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTY 218 Query: 517 PWFLRNVDLHDDLELDSFSKYLQSASLRHFEK 422 + DL L DS Q A L F K Sbjct: 219 DPRASSSDLVKSLNWDSLEVRRQLAQLCLFYK 250 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 533 P ++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 576 PESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 205 YRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 240 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 759 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 818 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 819 EVRRQLAQLCLFYK 832 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 163 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 222 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 223 EVRRQLAQLCLFYK 236 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 30.3 bits (65), Expect = 2.0 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = -3 Query: 401 SHRSRWKLHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNP-SLATKGST 225 SHR R KL RP + +G +T+ K H I S +P S AT ++ Sbjct: 593 SHRRRHKLRARPFQADGTDTTNSKLTHRDELSYIPLKSSSSGSTQTSRDSPRSTATFLAS 652 Query: 224 SELTHRHSPLSFSPDLLSGS 165 S+ P+S S D SGS Sbjct: 653 SDSHGAAFPVSASIDTHSGS 672 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 39 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 98 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 99 EVRRQLAQLCLFYK 112 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 125 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 184 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 185 EVRRQLAQLCLFYK 198 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 84 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 143 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 144 EVRRQLAQLCLFYK 157 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 1466 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 1525 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 1526 EVRRQLAQLCLFYK 1539 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 84 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 143 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 144 EVRRQLAQLCLFYK 157 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 450 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 509 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 510 EVRRQLAQLCLFYK 523 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 263 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 322 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 323 EVRRQLAQLCLFYK 336 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 123 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 182 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 183 EVRRQLAQLCLFYK 196 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 678 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 737 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 738 EVRRQLAQLCLFYK 751 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y + IRPVM YAS V+ ++ L+ +Q R G + DL L DS Sbjct: 145 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLNWDSL 204 Query: 463 SKYLQSASLRHFEK 422 Q A L F K Sbjct: 205 EVRRQLAQLCLFYK 218 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 527 Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 65 YRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL+ +Q R Sbjct: 28 YRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL+ +Q R Sbjct: 410 YRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAP 515 Y++ +R + YASVVFA R SL+ +Q C +A+ P Sbjct: 476 YRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 527 Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 65 YRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL+ +Q R Sbjct: 28 YRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 29.9 bits (64), Expect = 2.6 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 8/83 (9%) Frame = -3 Query: 407 EPSHRS-RWK-LH----TRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPS--SSN 252 +P+ RS RWK LH + S N P TSP + S N A H SPS SS Sbjct: 2792 KPTARSIRWKELHCNTSSSSSSQNTSPGTSPYTSSHQIGRSPNHALPHPSTGSPSQPSSR 2851 Query: 251 PSLATKGSTSELTHRHSPLSFSP 183 PS ++ +++ + HS S SP Sbjct: 2852 PSRSSSFYSAQGSF-HSFTSLSP 2873 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 Y+T +RP + YA++ + + N+ +++IQ R I Sbjct: 179 YRTLVRPKLEYATIAWNPYTQCNINKIEMIQRRAASI 215 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL+ +Q R Sbjct: 9 YRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 530 ++TC+RP+ YA V+ + + L SL+ +Q R RI Sbjct: 289 FRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/47 (21%), Positives = 27/47 (57%) Frame = -1 Query: 664 PSVIR*LXYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAV 524 P+ ++ YK +RP++ Y + ++ + +++ ++ +Q C+I V Sbjct: 246 PAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRPRCQICV 292 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 530 Y + IR ++ YA+VVF++ + ++L+ +Q R RI Sbjct: 135 YCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLK-SLQVIQSRFCRIA 527 Y TC+RP++ Y + + HA LK L+ IQ IA Sbjct: 292 YDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 >SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) Length = 416 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 412 VVPPSQNGAAMPTVDTY*KSRAPGRR 489 VV P QNG +P TY +S PG R Sbjct: 16 VVSPYQNGTEIPFPQTYSRSHIPGSR 41 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 530 ++TC+RP+ YA V+ + + L SL+ +Q R RI Sbjct: 683 FRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +2 Query: 320 NDVLWATSTVYHSVYWVG-----YVISSGYDERVLMSCRLLKMAQ 439 NDVL +YH VYW G ++S ++E V SC K+ + Sbjct: 22 NDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTE 66 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 521 Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 263 YFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 263 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 263 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 227 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 262 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 284 HHKHRSPSSSNPSLATKGSTSELTHRHSP-LSFSP 183 HH+H SPSS +PS + H H P LS SP Sbjct: 605 HHRH-SPSSPSPSCIAIITVIHYRHNHHPALSSSP 638 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 179 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 214 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 263 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 819 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 854 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 117 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 152 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 707 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 742 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 212 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 247 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL +Q R Sbjct: 28 YRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 377 HTRPSRPNGKPSTSPKARHYGSS 309 HTRP+R G+P+T P H+ S Sbjct: 502 HTRPTRTVGRPATLPPQSHHHRS 524 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 887 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 922 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 533 Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 677 YRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 712 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL +Q R Sbjct: 636 YRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) Length = 522 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = -3 Query: 368 PSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSF 189 P P+G+P + + + + + HHK+ +S L T +S R SPL+ Sbjct: 92 PRPPSGRPQSRRRKKSATNELRVRRKSSHHKYTEDASRLTGLPTHRISS--YKRDSPLAL 149 Query: 188 SPDL 177 P L Sbjct: 150 QPSL 153 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 542 Y++ +R + YASVVFA R SL +Q R Sbjct: 152 YRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 178 RSGEKLSGLCLWVSSLVE 231 R+G + G+CLWV S++E Sbjct: 12 RNGSSVPGMCLWVVSIIE 29 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 28.3 bits (60), Expect = 8.0 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 1/103 (0%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y T +RP++ YA+ + T++ L+ +Q R + L DL D+ Sbjct: 51 YFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNAARFVTNTYDPYASTTKLVKDLSWDTL 110 Query: 463 SKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRR 335 + ++ F K N LI A +PD V R RR Sbjct: 111 EQRRLTSQAILFYK---FHNSLIYAK---LPDLVTRSTRSTRR 147 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 28.3 bits (60), Expect = 8.0 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 1/103 (0%) Frame = -1 Query: 640 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLELDSF 464 Y T +RP++ YA+ + T++ L+ +Q R + L DL D+ Sbjct: 411 YFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNAARFVTNTYDPYASTTKLVKDLSWDTL 470 Query: 463 SKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRR 335 + ++ F K N LI A +PD V R RR Sbjct: 471 EQRRLTSQAILFYK---FHNSLIYAK---LPDLVTRSTRSTRR 507 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 646 LXYKTCIRPVMTYASVVFAHAARTNLKS-LQVIQSRFCRI 530 L Y TCIRP YA +F ++ L + L+ Q R RI Sbjct: 687 LFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,706,700 Number of Sequences: 59808 Number of extensions: 481589 Number of successful extensions: 1756 Number of sequences better than 10.0: 78 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1744 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -