BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I09 (789 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 26 0.46 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.9 AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 5.7 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.5 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 25.8 bits (54), Expect = 0.46 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 81 SILISNAAVCSSRFVLSAGVYWRVVR 158 ++LI+ +CSS A V+WR VR Sbjct: 164 AVLIAIVWICSSAISFPAIVWWRAVR 189 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 188 YPTNRSLCYRPNNAPVY--SC*KNKSRRAHSSV 96 YPTNRSL R +Y ++K RRA + Sbjct: 131 YPTNRSLFIREQTEEMYREMLLEHKKRRARRDI 163 Score = 21.4 bits (43), Expect = 9.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 285 QEAFAVAVSAGFVDRLNAPSDPGCTVEHWP 374 +E + +V +G +DRL+ +DP C V ++P Sbjct: 698 KEGYLHSVVSGALDRLHYETDP-C-VRYYP 725 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 266 CAALGMPGGICCGGFCWFRGSLERTLGSGLYG 361 C +LG GG C G C R + + L +G Sbjct: 64 CLSLGKAGGHCEKGVCICRKTSFKDLWDKRFG 95 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 586 IIVYRWLCWWWIGWYIS 636 +I Y CWW I W I+ Sbjct: 482 MIGYYPCCWWKICWTIT 498 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 586 IIVYRWLCWWWIGWYIS 636 +I Y CWW I W I+ Sbjct: 535 MIGYYPCCWWKICWTIT 551 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 387 RDPRLANAPPYNPDPRVRSSDP 322 R+P LA A PYN V S P Sbjct: 885 RNPALALAEPYNQRGTVVSPPP 906 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 387 RDPRLANAPPYNPDPRVRSSDP 322 R+P LA A PYN V S P Sbjct: 923 RNPALALAEPYNQRGTVVSPPP 944 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,412 Number of Sequences: 438 Number of extensions: 4139 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -