BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I07 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 37 0.020 SB_7540| Best HMM Match : Transgly_assoc (HMM E-Value=0.46) 28 7.1 SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = -2 Query: 635 KISKGTIEIINDVHILKPGDKVGA 564 KI++GTIEIINDVH++K +K+ A Sbjct: 128 KIARGTIEIINDVHLIKKDEKLKA 151 >SB_7540| Best HMM Match : Transgly_assoc (HMM E-Value=0.46) Length = 320 Score = 28.3 bits (60), Expect = 7.1 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = -2 Query: 572 VGASEATLLNMLNISPFSYGLVVKQVYD---SGTIFAP-EILDIKPEDLRAKFQAGVANV 405 + S + + +L +SP YG+ + +G +F IL + PE + + A VA Sbjct: 82 IAGSSSVYIGLLGLSPAQYGITFAAIVSALIAGALFTQRRILQLGPEKIVSIGAALVATG 141 Query: 404 AALSLAI 384 A +LAI Sbjct: 142 ALTTLAI 148 >SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -3 Query: 529 LHSHMVLLLSRYMILELFLHLKFWTSNQKIS 437 L S +++++ RY+ + LH + W S +K+S Sbjct: 145 LLSMLLMMVDRYIAIAWGLHYRIWKSQRKVS 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,211,616 Number of Sequences: 59808 Number of extensions: 297586 Number of successful extensions: 645 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -