BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I06 (867 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 24 1.8 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 9.5 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 753 TPXKTRXNXFXTSGRSLTPRTIPFGM 676 +P + F +GRS T + +PFG+ Sbjct: 406 SPESRQYTAFLYNGRSYTYQVLPFGL 431 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/43 (25%), Positives = 15/43 (34%) Frame = +2 Query: 548 SSPNRQTDAKACLRILSNLWKHTRNKVTAHEHFXEXSGVFVFS 676 S PN + AC LS+ W + +F FS Sbjct: 22 SGPNATLQSSACTDDLSSCWSEDMGSFSLPLDLEPLPSLFPFS 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,723 Number of Sequences: 336 Number of extensions: 4196 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23893023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -