BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I04 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 27 0.50 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 26 1.1 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 8.1 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 8.1 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 27.5 bits (58), Expect = 0.50 Identities = 22/58 (37%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +3 Query: 246 PAAPGPLEDVEGDPALVDRVEVVRLDGARRVEGRPEGDTRVA--RRLPALVVPP--YH 407 PA+ G L V DP +V R +VV + A + GDT V L VPP YH Sbjct: 102 PASYGNLNVVRWDPTIVWRPDVVLYNNAGGSDQHHYGDTNVLVYSEGKVLWVPPTEYH 159 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 26.2 bits (55), Expect = 1.1 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 237 TGLPAAPGPLEDVEGDPALVDRVEVVRLDGARRVEGRP 350 TGLP PGP V+G P V DG + +G P Sbjct: 393 TGLPGIPGP-PCVDGLPGAAGPVGPRGYDGEKGFKGEP 429 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 509 GAPGCVVSMENVPFRATIDEILQFFSEFELSHDDVIRRYNERGQP 375 GA S+++ + ++ +E++ HDD + RY + G P Sbjct: 29 GAVSVSASLQHYVVEKSFNQAQAECAEYQGVHDDDLLRYVKEGYP 73 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 509 GAPGCVVSMENVPFRATIDEILQFFSEFELSHDDVIRRYNERGQP 375 GA S+++ + ++ +E++ HDD + RY + G P Sbjct: 29 GAVSVSASLQHYVVEKSFNQAQAECAEYQGVHDDDLLRYVKEGYP 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,884 Number of Sequences: 2352 Number of extensions: 9373 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -