BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_I01 (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0) 111 8e-25 SB_39902| Best HMM Match : Glycolytic (HMM E-Value=1.2) 91 7e-19 SB_29696| Best HMM Match : Herpes_US9 (HMM E-Value=0.56) 32 0.60 SB_21175| Best HMM Match : GLYCAM-1 (HMM E-Value=1) 31 0.79 SB_2772| Best HMM Match : DUF1279 (HMM E-Value=1.3) 31 0.79 SB_35962| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_53284| Best HMM Match : DUF1279 (HMM E-Value=1.5) 31 1.4 SB_14512| Best HMM Match : IncA (HMM E-Value=0.12) 31 1.4 SB_58746| Best HMM Match : RA (HMM E-Value=0.85) 31 1.4 SB_52973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38721| Best HMM Match : Methionine_synt (HMM E-Value=1.5) 30 1.8 SB_7380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_54449| Best HMM Match : bZIP_2 (HMM E-Value=1.2) 30 1.8 SB_31492| Best HMM Match : DUF1279 (HMM E-Value=0.38) 30 1.8 SB_59698| Best HMM Match : Flp_Fap (HMM E-Value=0.83) 30 2.4 SB_57351| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_56646| Best HMM Match : Phage_GP20 (HMM E-Value=1.7) 30 2.4 SB_56090| Best HMM Match : BenE (HMM E-Value=0.2) 30 2.4 SB_54541| Best HMM Match : bZIP_1 (HMM E-Value=1.9) 30 2.4 SB_52983| Best HMM Match : GntP_permease (HMM E-Value=1.2) 30 2.4 SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) 30 2.4 SB_47658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_45510| Best HMM Match : DUF1279 (HMM E-Value=1.2) 30 2.4 SB_43095| Best HMM Match : DUF1279 (HMM E-Value=0.52) 30 2.4 SB_42844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_41373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_40208| Best HMM Match : DUF1212 (HMM E-Value=2.3) 30 2.4 SB_39573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_37465| Best HMM Match : UPF0075 (HMM E-Value=1.2) 30 2.4 SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) 30 2.4 SB_35830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_35437| Best HMM Match : DUF1212 (HMM E-Value=1.5) 30 2.4 SB_35158| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.4 SB_32773| Best HMM Match : DUF1279 (HMM E-Value=0.45) 30 2.4 SB_31573| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_30815| Best HMM Match : Sas10_Utp3 (HMM E-Value=1) 30 2.4 SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) 30 2.4 SB_27942| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.4 SB_27018| Best HMM Match : DUF1279 (HMM E-Value=1.3) 30 2.4 SB_23872| Best HMM Match : DUF1279 (HMM E-Value=0.77) 30 2.4 SB_23744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_22332| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 30 2.4 SB_21215| Best HMM Match : DUF1279 (HMM E-Value=0.54) 30 2.4 SB_19033| Best HMM Match : GLYCAM-1 (HMM E-Value=1.8) 30 2.4 SB_15806| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.4 SB_15621| Best HMM Match : DUF1279 (HMM E-Value=1.7) 30 2.4 SB_13335| Best HMM Match : DUF1279 (HMM E-Value=0.43) 30 2.4 SB_4184| Best HMM Match : DUF1279 (HMM E-Value=0.45) 30 2.4 SB_3751| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_775| Best HMM Match : bZIP_2 (HMM E-Value=3) 30 2.4 SB_449| Best HMM Match : Adeno_PIX (HMM E-Value=0.8) 30 2.4 SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_58514| Best HMM Match : DUF1279 (HMM E-Value=1.8) 30 2.4 SB_56962| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 30 2.4 SB_51765| Best HMM Match : CHASE3 (HMM E-Value=2.6) 30 2.4 SB_48416| Best HMM Match : DUF1279 (HMM E-Value=1.7) 30 2.4 SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_34046| Best HMM Match : DUF1279 (HMM E-Value=0.19) 30 2.4 SB_33326| Best HMM Match : DUF1279 (HMM E-Value=1.4) 30 2.4 SB_30740| Best HMM Match : DUF1279 (HMM E-Value=0.42) 30 2.4 SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) 30 2.4 SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) 30 2.4 SB_29183| Best HMM Match : DUF1279 (HMM E-Value=0.89) 30 2.4 SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) 30 2.4 SB_24711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_23011| Best HMM Match : Mo-nitro_C (HMM E-Value=1.4) 30 2.4 SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) 30 2.4 SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) 30 2.4 SB_15367| Best HMM Match : DUF1212 (HMM E-Value=0.98) 30 2.4 SB_15118| Best HMM Match : IncA (HMM E-Value=0.44) 30 2.4 SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) 30 2.4 SB_10025| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) 30 2.4 SB_8165| Best HMM Match : DUF1279 (HMM E-Value=3.6) 30 2.4 SB_5649| Best HMM Match : DUF1212 (HMM E-Value=2.6) 30 2.4 SB_5508| Best HMM Match : bZIP_2 (HMM E-Value=3) 30 2.4 SB_4222| Best HMM Match : DUF1279 (HMM E-Value=1.8) 30 2.4 SB_1332| Best HMM Match : FeoB_N (HMM E-Value=0.94) 30 2.4 SB_999| Best HMM Match : DUF1279 (HMM E-Value=1.2) 30 2.4 SB_370| Best HMM Match : DUF1279 (HMM E-Value=0.35) 30 2.4 SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) 29 3.2 SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) 29 3.2 SB_29565| Best HMM Match : DUF1279 (HMM E-Value=0.35) 29 3.2 SB_20149| Best HMM Match : DUF837 (HMM E-Value=0.65) 29 3.2 SB_11057| Best HMM Match : Cornichon (HMM E-Value=4.5e-07) 29 3.2 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 29 3.2 SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_29337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_15318| Best HMM Match : DUF1279 (HMM E-Value=0.78) 29 3.2 SB_7883| Best HMM Match : Adeno_PIX (HMM E-Value=1.2) 29 4.2 SB_472| Best HMM Match : Cas1p (HMM E-Value=0) 29 4.2 SB_52542| Best HMM Match : DUF1279 (HMM E-Value=0.96) 29 4.2 SB_46829| Best HMM Match : DUF1279 (HMM E-Value=0.49) 29 4.2 SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3290| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_48040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_13542| Best HMM Match : GvpG (HMM E-Value=2) 29 5.5 SB_40932| Best HMM Match : GvpG (HMM E-Value=2) 29 5.5 SB_40741| Best HMM Match : UreF (HMM E-Value=0.65) 28 7.3 SB_38995| Best HMM Match : Phage_Nu1 (HMM E-Value=1.3) 28 7.3 SB_10565| Best HMM Match : DUF1279 (HMM E-Value=1.3) 28 7.3 SB_24319| Best HMM Match : DUF1279 (HMM E-Value=0.58) 28 7.3 SB_19216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_13006| Best HMM Match : DUF1279 (HMM E-Value=2.9) 28 7.3 SB_33648| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_30655| Best HMM Match : DUF1279 (HMM E-Value=0.5) 28 9.7 SB_26622| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_13304| Best HMM Match : IncA (HMM E-Value=0.3) 28 9.7 SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_59011| Best HMM Match : DUF1279 (HMM E-Value=0.51) 28 9.7 SB_38377| Best HMM Match : Transgly_assoc (HMM E-Value=4) 28 9.7 SB_37967| Best HMM Match : DUF1279 (HMM E-Value=0.28) 28 9.7 SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) 28 9.7 SB_19210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_26182| Best HMM Match : Glycolytic (HMM E-Value=0) Length = 949 Score = 111 bits (266), Expect = 8e-25 Identities = 56/103 (54%), Positives = 69/103 (66%) Frame = -3 Query: 732 PGXTFLXRXQSEXXXSVHXNAINAVXLKXPWVLTFXYGRALQASVLRAWEGKTENILAGQ 553 PG TFL QSE ++H NAIN K PW LTF +GRALQAS L+AW GK+ + AGQ Sbjct: 264 PGVTFLSGGQSEEQATIHLNAINQYQGKKPWKLTFSFGRALQASALKAWSGKSGCVKAGQ 323 Query: 552 QELIKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAY*MRT 424 +E +KRAKANG AA+GKY G SLA +S FV +H ++T Sbjct: 324 EEFLKRAKANGQAAMGKYAGGQ--SLAGDQSLFVANHQIPVQT 364 >SB_39902| Best HMM Match : Glycolytic (HMM E-Value=1.2) Length = 71 Score = 91.5 bits (217), Expect = 7e-19 Identities = 43/72 (59%), Positives = 53/72 (73%) Frame = -3 Query: 651 KXPWVLTFXYGRALQASVLRAWEGKTENILAGQQELIKRAKANGLAAVGKYVAGSIPSLA 472 K PW LTF +GRALQAS L+AW GK++ + AGQ+E +KRAKANG AA+GKY G SLA Sbjct: 2 KKPWKLTFSFGRALQASALKAWSGKSDCVKAGQEEFLKRAKANGQAAMGKYAGGQ--SLA 59 Query: 471 ASKSNFVKSHAY 436 +S FV +H Y Sbjct: 60 GDQSLFVANHQY 71 >SB_29696| Best HMM Match : Herpes_US9 (HMM E-Value=0.56) Length = 632 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -3 Query: 564 LAGQQELIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 LA + R NGL A+GK + +P L AS +NFV Sbjct: 240 LAKSLSSVARGVGNGLEAIGKKLFERLPGLVASIANFV 277 >SB_21175| Best HMM Match : GLYCAM-1 (HMM E-Value=1) Length = 280 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 546 LIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 L+ R NGL A+GK + +P L S +NFV Sbjct: 212 LVARGVGNGLKAIGKKLGELLPGLVGSIANFV 243 >SB_2772| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 179 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L AS +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVASIANFV 142 >SB_35962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGELLPGLVGSNANFV 289 >SB_53284| Best HMM Match : DUF1279 (HMM E-Value=1.5) Length = 427 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAY*MRT 424 + R NGL A+GK + +P L S +NFV A+ R+ Sbjct: 231 VARGVGNGLKAIGKKLGELLPGLVGSIANFVFKAAHSSRS 270 >SB_14512| Best HMM Match : IncA (HMM E-Value=0.12) Length = 642 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFVKSHAY*MRT 424 + R NGL A+GK + +P L S +NFV A+ R+ Sbjct: 231 VPRGVGNGLKAIGKKLGELLPGLVGSIANFVFKAAHSSRS 270 >SB_58746| Best HMM Match : RA (HMM E-Value=0.85) Length = 820 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGAGNGLKAIGKKLGELLPGLVGSVANFV 231 >SB_52973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 973 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGERLPGLVGSIANFV 289 >SB_38721| Best HMM Match : Methionine_synt (HMM E-Value=1.5) Length = 329 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 230 VARGVGNGLKAIGKMLGELLPGLVGSIANFV 260 >SB_7380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGAGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_54449| Best HMM Match : bZIP_2 (HMM E-Value=1.2) Length = 258 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L +S +NFV Sbjct: 202 VARGVGNGLKAIGKKLGELLPGLVSSIANFV 232 >SB_31492| Best HMM Match : DUF1279 (HMM E-Value=0.38) Length = 327 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L +S +NFV Sbjct: 260 VARGVGNGLKAIGKKLGELLPGLVSSIANFV 290 >SB_59698| Best HMM Match : Flp_Fap (HMM E-Value=0.83) Length = 293 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_57351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_56646| Best HMM Match : Phage_GP20 (HMM E-Value=1.7) Length = 238 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_56090| Best HMM Match : BenE (HMM E-Value=0.2) Length = 520 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 211 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 241 >SB_54541| Best HMM Match : bZIP_1 (HMM E-Value=1.9) Length = 294 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_52983| Best HMM Match : GntP_permease (HMM E-Value=1.2) Length = 683 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_50251| Best HMM Match : Transgly_assoc (HMM E-Value=4) Length = 158 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 91 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 121 >SB_47658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 249 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 279 >SB_45510| Best HMM Match : DUF1279 (HMM E-Value=1.2) Length = 148 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 81 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 111 >SB_43095| Best HMM Match : DUF1279 (HMM E-Value=0.52) Length = 281 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 214 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 244 >SB_42844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 902 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 932 >SB_41373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 249 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 279 >SB_40208| Best HMM Match : DUF1212 (HMM E-Value=2.3) Length = 150 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_39573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_37465| Best HMM Match : UPF0075 (HMM E-Value=1.2) Length = 336 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_36761| Best HMM Match : DUF1279 (HMM E-Value=0.23) Length = 244 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 104 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 134 >SB_35830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 577 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 244 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 274 >SB_35437| Best HMM Match : DUF1212 (HMM E-Value=1.5) Length = 184 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 128 VARGGGNGLKAIGKRLCELLPGLVGSIANFV 158 >SB_35158| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_32773| Best HMM Match : DUF1279 (HMM E-Value=0.45) Length = 231 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 64 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 94 >SB_31573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 280 >SB_30815| Best HMM Match : Sas10_Utp3 (HMM E-Value=1) Length = 864 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 203 VARGVCNGLKAIGKKLGELLPGLVGSIANFV 233 >SB_28291| Best HMM Match : DUF1131 (HMM E-Value=2.3) Length = 421 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 354 VARGVGNGLQAIGKKLGELLPGLVGSIANFV 384 >SB_27942| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_27018| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 334 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 232 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 262 >SB_23872| Best HMM Match : DUF1279 (HMM E-Value=0.77) Length = 268 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_23744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 189 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 219 >SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1013 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_22332| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 272 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 205 VARGVGNGLKAIGKKLGEFLPGLVGSIANFV 235 >SB_21215| Best HMM Match : DUF1279 (HMM E-Value=0.54) Length = 756 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 257 VARGVCNGLKAIGKKLGELLPGLVGSIANFV 287 >SB_19033| Best HMM Match : GLYCAM-1 (HMM E-Value=1.8) Length = 311 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15806| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15621| Best HMM Match : DUF1279 (HMM E-Value=1.7) Length = 323 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_13335| Best HMM Match : DUF1279 (HMM E-Value=0.43) Length = 319 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 252 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 282 >SB_4184| Best HMM Match : DUF1279 (HMM E-Value=0.45) Length = 287 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 114 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 144 >SB_3751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 166 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 196 >SB_775| Best HMM Match : bZIP_2 (HMM E-Value=3) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_449| Best HMM Match : Adeno_PIX (HMM E-Value=0.8) Length = 217 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 157 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 187 >SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 289 >SB_58514| Best HMM Match : DUF1279 (HMM E-Value=1.8) Length = 319 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 252 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 282 >SB_56962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 89 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 119 >SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 716 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 649 VARGVGNGLKAIGKKLGEFLPGLVGSIANFV 679 >SB_51765| Best HMM Match : CHASE3 (HMM E-Value=2.6) Length = 256 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 189 VDRGVGNGLKAIGKKLGELLPGLVGSIANFV 219 >SB_48416| Best HMM Match : DUF1279 (HMM E-Value=1.7) Length = 323 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_41375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 257 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 287 >SB_34046| Best HMM Match : DUF1279 (HMM E-Value=0.19) Length = 287 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 220 VARGVGNGLKAIGKKLGKLLPGLVGSIANFV 250 >SB_33326| Best HMM Match : DUF1279 (HMM E-Value=1.4) Length = 326 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 259 VARGVGNGLKAIGKKLGEILPGLVGSIANFV 289 >SB_30740| Best HMM Match : DUF1279 (HMM E-Value=0.42) Length = 179 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) Length = 1502 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 1320 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 1350 >SB_29912| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00036) Length = 618 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 602 RCSAPGKGRPRTFSPDSRS*SSVLRPTVSQQSANTLPALFLRW 474 +C APG+ R +PD + + +A+ LP +FL W Sbjct: 101 KCGAPGRFAARCRAPDDAAGAVTQGGRAEPVTASALPPMFLEW 143 >SB_29183| Best HMM Match : DUF1279 (HMM E-Value=0.89) Length = 253 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 202 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 232 >SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) Length = 239 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 172 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 202 >SB_24711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 256 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 286 >SB_23011| Best HMM Match : Mo-nitro_C (HMM E-Value=1.4) Length = 420 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 213 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 243 >SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) Length = 407 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 201 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 231 >SB_19157| Best HMM Match : FLO_LFY (HMM E-Value=0.27) Length = 560 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 207 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 237 >SB_15367| Best HMM Match : DUF1212 (HMM E-Value=0.98) Length = 286 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_15118| Best HMM Match : IncA (HMM E-Value=0.44) Length = 835 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) Length = 498 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_10025| Best HMM Match : GLYCAM-1 (HMM E-Value=1.3) Length = 517 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_8165| Best HMM Match : DUF1279 (HMM E-Value=3.6) Length = 310 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 243 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 273 >SB_5649| Best HMM Match : DUF1212 (HMM E-Value=2.6) Length = 293 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_5508| Best HMM Match : bZIP_2 (HMM E-Value=3) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_4222| Best HMM Match : DUF1279 (HMM E-Value=1.8) Length = 179 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 142 >SB_1332| Best HMM Match : FeoB_N (HMM E-Value=0.94) Length = 348 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_999| Best HMM Match : DUF1279 (HMM E-Value=1.2) Length = 637 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 280 >SB_370| Best HMM Match : DUF1279 (HMM E-Value=0.35) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELLPGLVGSIANFV 285 >SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) Length = 297 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 230 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 260 >SB_38193| Best HMM Match : DUF1279 (HMM E-Value=4.5) Length = 351 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 143 VARGFGNGLKAIGKKLGELLPGLVGSIANFV 173 >SB_29565| Best HMM Match : DUF1279 (HMM E-Value=0.35) Length = 284 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 204 VARGFGNGLKAIGKKLGELLPGLVGSIANFV 234 >SB_20149| Best HMM Match : DUF837 (HMM E-Value=0.65) Length = 317 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 250 VARGAGNGLKAIGKKLGELLPVLVGSIANFV 280 >SB_11057| Best HMM Match : Cornichon (HMM E-Value=4.5e-07) Length = 340 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 546 LIKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 L+ + NGL A+GK + +P L S +NFV Sbjct: 196 LLGKGVGNGLKAIGKKLGELLPGLVGSIANFV 227 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 576 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 606 >SB_50868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 213 VARGIGNGLKAIGKKLGELLPGLVGSIANFV 243 >SB_29337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 238 VARGVGNGLKAIGKKLGELLPRLVGSIANFV 268 >SB_15318| Best HMM Match : DUF1279 (HMM E-Value=0.78) Length = 329 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 262 VAREVGNGLKAIGKKLGELLPGLVGSIANFV 292 >SB_7883| Best HMM Match : Adeno_PIX (HMM E-Value=1.2) Length = 282 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL AVGK + +P L S S FV Sbjct: 243 VARGVGNGLKAVGKKLGELLPGLVGSISRFV 273 >SB_472| Best HMM Match : Cas1p (HMM E-Value=0) Length = 932 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + P L S +NFV Sbjct: 255 VARGVGNGLKAIGKKLGELFPGLVGSIANFV 285 >SB_52542| Best HMM Match : DUF1279 (HMM E-Value=0.96) Length = 179 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK ++ +P L S +NFV Sbjct: 112 VARGVGNGLKAIGKKLSELLPWLVGSIANFV 142 >SB_46829| Best HMM Match : DUF1279 (HMM E-Value=0.49) Length = 224 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + P L S +NFV Sbjct: 157 VARGVGNGLKAIGKKLGELFPGLVGSIANFV 187 >SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NFV Sbjct: 196 VARGVGNGLKAIGKKLDELLPGLVGSIANFV 226 >SB_3290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 537 RAKANGLAAVGKYVAGSIPSLAASKSNFV 451 R+ NGL A+GK + +P L S +NFV Sbjct: 261 RSVGNGLKAIGKKLGVLLPGLVGSIANFV 289 >SB_48040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S +NF+ Sbjct: 157 VARGVGNGLKAIGKKLGELLPGLVGSIANFL 187 >SB_13542| Best HMM Match : GvpG (HMM E-Value=2) Length = 264 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK +P L S +NFV Sbjct: 197 VARGVGNGLKAIGKKPGELLPGLVGSIANFV 227 >SB_40932| Best HMM Match : GvpG (HMM E-Value=2) Length = 438 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK +P L S +NFV Sbjct: 371 VARGVGNGLKAIGKKPGELLPGLVGSIANFV 401 >SB_40741| Best HMM Match : UreF (HMM E-Value=0.65) Length = 266 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 454 + R NGL A+GK + +P L S +NF Sbjct: 201 VARGVGNGLKAIGKALGELLPRLVGSVANF 230 >SB_38995| Best HMM Match : Phage_Nu1 (HMM E-Value=1.3) Length = 226 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL +GK + +P L S +NFV Sbjct: 159 VARGVGNGLKTIGKKLGELLPGLVGSIANFV 189 >SB_10565| Best HMM Match : DUF1279 (HMM E-Value=1.3) Length = 177 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 454 + R NGL A+GK + +P L S +NF Sbjct: 112 VARGVGNGLKAIGKALGELLPRLVGSVANF 141 >SB_24319| Best HMM Match : DUF1279 (HMM E-Value=0.58) Length = 383 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK +P L S +NFV Sbjct: 213 VARGVGNGLNAIGKKPGELLPGLVGSIANFV 243 >SB_19216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK +P L S +NFV Sbjct: 213 VARGVGNGLNAIGKKPGELLPGLVGSIANFV 243 >SB_13006| Best HMM Match : DUF1279 (HMM E-Value=2.9) Length = 252 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 454 + R NGL A+GK + +P L S +NF Sbjct: 203 VARGVGNGLKAIGKKLGELLPGLVGSIANF 232 >SB_33648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L S ++FV Sbjct: 237 VARGVGNGLKAIGKKLGELLPGLVGSIASFV 267 >SB_30655| Best HMM Match : DUF1279 (HMM E-Value=0.5) Length = 692 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L +NF+ Sbjct: 244 VARGVGNGLKAIGKKLGNLLPGLVGGIANFM 274 >SB_26622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 633 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L +NF+ Sbjct: 244 VARGVGNGLKAIGKKLGNLLPGLVGGIANFM 274 >SB_13304| Best HMM Match : IncA (HMM E-Value=0.3) Length = 611 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 537 RAKANGLAAVGKYVAGSIPSLAASKSNFV 451 R NGL A+GK + +P L S +NFV Sbjct: 113 RGVGNGLKAIGKKLGELLPWLVGSIANFV 141 >SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P+L S +N V Sbjct: 253 VARGVGNGLKAIGKKLGELLPALVGSIANLV 283 >SB_59011| Best HMM Match : DUF1279 (HMM E-Value=0.51) Length = 235 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R NGL A+GK + +P L +NFV Sbjct: 168 VARGVGNGLKAIGKKLGELLPGLVGCIANFV 198 >SB_38377| Best HMM Match : Transgly_assoc (HMM E-Value=4) Length = 120 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 525 NGLAAVGKYVAGSIPSLAASKSNFV 451 NGL A+GK + +P L S +NFV Sbjct: 5 NGLKAIGKKLGELLPGLVGSIANFV 29 >SB_37967| Best HMM Match : DUF1279 (HMM E-Value=0.28) Length = 233 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 454 + R NGL A+GK + +P L S +NF Sbjct: 112 VARRVGNGLKAIGKKLGELLPGLVGSIANF 141 >SB_26684| Best HMM Match : DUF1279 (HMM E-Value=0.52) Length = 464 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNFV 451 + R +GL A+GK + +P L S +NFV Sbjct: 214 VARGVGDGLKAIGKKLGELLPGLVGSIANFV 244 >SB_19210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 543 IKRAKANGLAAVGKYVAGSIPSLAASKSNF 454 + R NGL A+GK + +P L S +NF Sbjct: 112 VARRVGNGLKAIGKKLGELLPGLVGSIANF 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,565,486 Number of Sequences: 59808 Number of extensions: 343422 Number of successful extensions: 747 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -